DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and AT1G12340

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_563903.2 Gene:AT1G12340 / 837788 AraportID:AT1G12340 Length:129 Species:Arabidopsis thaliana


Alignment Length:118 Identity:35/118 - (29%)
Similarity:61/118 - (51%) Gaps:7/118 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRY 89
            |||::...:|:.||.||.|..:.:|.:||||:::...|.:.:|..|.||...:.:|.:.|:...|
plant    14 IFHLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLCVFYLLTGHWFMTLLCLPYLYYNFHLY 78

  Fly    90 KNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLI 142
            ..|     ..|.|.|.:.  :.|....::...|||..:::.|..|:.|:||.:
plant    79 SKR-----QHLVDVTEIF--NLLNWEKKKRLFKLAYIVLNLFLTIFWMIYSAL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 31/109 (28%)
AT1G12340NP_563903.2 Cornichon 14..117 CDD:397410 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm2862
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.