DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and AT3G12180

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_187825.1 Gene:AT3G12180 / 820395 AraportID:AT3G12180 Length:146 Species:Arabidopsis thaliana


Alignment Length:142 Identity:41/142 - (28%)
Similarity:67/142 - (47%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLL 65
            ||::.  |.:||:......|:....:.||...:|:.||.||.:....:|.||:||::|...|.||
plant     1 MAWDL--FLWIVSFFVSLALVASVFYQVICLTDLEADYLNPFETSTRINRLVIPEFILQGSLCLL 63

  Fly    66 FLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISF 130
            ||....|....:.:|:..||...||.|..     |.|.|.|.:..:..:.:|  :.||..|:..|
plant    64 FLLTWHWVFFLVAVPVTVYHAMLYKERRY-----LIDVTEVFRGISFEKKLR--YTKLGFYVFLF 121

  Fly   131 FYYIYGMVYSLI 142
            ...::.:..|.:
plant   122 IMVVFRLTLSAV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 38/127 (30%)
AT3G12180NP_187825.1 Cornichon 5..126 CDD:397410 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3585
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2491
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm2862
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - LDO PTHR12290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.