DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and Cnih3

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_030099002.1 Gene:Cnih3 / 72978 MGIID:1920228 Length:187 Species:Mus musculus


Alignment Length:187 Identity:77/187 - (41%)
Similarity:104/187 - (55%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLN---------------- 49
            |||.|.||.|:::|:..|.||||||:|:||||||:||:|:||||||.::                
Mouse     1 MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLR 65

  Fly    50 ---------------------------PLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIW 87
                                       .||||||.:|....::||...||.:|.:|:||:.||.|
Mouse    66 KVRGVPPGGRRKGRRERGQQVNGSREGKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFW 130

  Fly    88 RYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLIST 144
            ||.:.|..|....|||..|:..|||....:|.|.|||.||:|||||:|.|:|:|:|:
Mouse   131 RYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 68/170 (40%)
Cnih3XP_030099002.1 Cornichon 8..178 CDD:367442 67/169 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839983
Domainoid 1 1.000 196 1.000 Domainoid score I3121
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3592
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52399
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm43619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.