DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and Cnih3

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001160050.1 Gene:Cnih3 / 690252 RGDID:1582859 Length:160 Species:Rattus norvegicus


Alignment Length:160 Identity:78/160 - (48%)
Similarity:103/160 - (64%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNS----------------LN 49
            |||.|.||.|:::|:..|.||||||:|:||||||:||:|:||||||.                |.
  Rat     1 MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLR 65

  Fly    50 PLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYR 114
            .||||||.:|....::||...||.:|.:|:||:.||.|||.:.|..|....|||..|:..|||..
  Rat    66 KLVLPEYSIHSLFCVMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSY 130

  Fly   115 NMREGWIKLAVYLISFFYYIYGMVYSLIST 144
            ..:|.|.|||.||:|||||:|.|:|:|:|:
  Rat   131 CQKEAWCKLAFYLLSFFYYLYCMIYTLVSS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 69/143 (48%)
Cnih3NP_001160050.1 Cornichon 7..151 CDD:308754 69/143 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343834
Domainoid 1 1.000 185 1.000 Domainoid score I3291
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3649
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm45694
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.