DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and cnih3

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_021324333.1 Gene:cnih3 / 564015 ZFINID:ZDB-GENE-041001-180 Length:178 Species:Danio rerio


Alignment Length:177 Identity:67/177 - (37%)
Similarity:101/177 - (57%) Gaps:35/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLN------------------ 49
            |.|.||.|:::|:..|.||||||:|:.|||||:.|:|.||||.|.|:                  
Zfish     2 FTFAAFCYMLSLVLCASLIFFAIWHITAFDELQADFKVPIDQGNPLHARERLRNIERICCLLRKQ 66

  Fly    50 ----------------PLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIW-RYKNRPVMSG 97
                            .||||||.:|:...::||...||.::.:||||:.|:.| ||.:.|..:.
Zfish    67 NWHSAVAKNCPVLPQLKLVLPEYSIHVLFCIMFLCAQEWLTVGLNIPLLFYNTWSRYFHSPTDTK 131

  Fly    98 PGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLIST 144
            ..||||.:|:..|||....:|.|.|::.:::|||||:|.|:|:|:::
Zfish   132 ELLYDPASVMNGDTLKFCQKEAWCKMSFFVLSFFYYLYCMIYTLVTS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 61/162 (38%)
cnih3XP_021324333.1 Cornichon 6..169 CDD:308754 61/162 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.