DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and cnih2

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001013542.1 Gene:cnih2 / 541397 ZFINID:ZDB-GENE-050320-96 Length:160 Species:Danio rerio


Alignment Length:159 Identity:76/159 - (47%)
Similarity:101/159 - (63%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQ----------------CNSLN 49
            |||.|.||.|::.|:..|.||||.|:.:||||||:||:||||||                ||.|.
Zfish     1 MAFTFAAFCYMLTLVLCAALIFFVIWQIIAFDELRTDFKNPIDQSNPTRARERILNIERICNLLR 65

  Fly    50 PLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYR 114
            .||:|||.:|....|:|:..|||.:|.:||||:.||:||:.:||......:|||.:|:..|.|..
Zfish    66 RLVVPEYSIHGLFCLMFMCAGEWVTLGLNIPLLLYHLWRFFHRPADGSEVMYDPVSVMNADILNY 130

  Fly   115 NMREGWIKLAVYLISFFYYIYGMVYSLIS 143
            ..:|.|.||..||:|||||:|.|||:|:|
Zfish   131 CQKESWCKLGFYLLSFFYYLYSMVYALVS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 66/143 (46%)
cnih2NP_001013542.1 Cornichon 7..151 CDD:397410 66/143 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm24305
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.