DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and Cnih1

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_038949026.1 Gene:Cnih1 / 289994 RGDID:1312030 Length:160 Species:Rattus norvegicus


Alignment Length:160 Identity:96/160 - (60%)
Similarity:119/160 - (74%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNP--------------- 50
            |||.|.||.|::||:..|.||||||:|:||||||||||||||||||:|||               
  Rat     1 MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPTVEKVKKIKRVKIAL 65

  Fly    51 -LVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYR 114
             |||||||:|.|..::||...||.:|.:|:||:|||||||.:||||||||||||||::..|.|..
  Rat    66 KLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAY 130

  Fly   115 NMREGWIKLAVYLISFFYYIYGMVYSLIST 144
            ..:|||.|||.||::||||:|||:|.|:|:
  Rat   131 CQKEGWCKLAFYLLAFFYYLYGMIYVLVSS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 86/143 (60%)
Cnih1XP_038949026.1 Cornichon 7..151 CDD:397410 86/143 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343835
Domainoid 1 1.000 185 1.000 Domainoid score I3291
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4219
Inparanoid 1 1.050 205 1.000 Inparanoid score I3649
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm45694
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - LDO PTHR12290
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.