DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and Cnih4

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001099451.1 Gene:Cnih4 / 289324 RGDID:1559740 Length:139 Species:Rattus norvegicus


Alignment Length:138 Identity:47/138 - (34%)
Similarity:79/138 - (57%) Gaps:3/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGE 71
            |..::.:|:....|||.:::.:|...:|:.||.|....|:.||..|:||.:.|.|:.:|.|....
  Rat     3 AVVFLFSLLDCCSLIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTFVTVLMLVSLH 67

  Fly    72 WFSLCINIPLIAYHIWRYKNRPVMSG-PGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIY 135
            |....:|:|:..::|:|:...|  || .|::|||.:.....|..:|:|..|||..||:.||.|:|
  Rat    68 WVIFLLNLPVATWNIYRFIMVP--SGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFYLLCFFMYLY 130

  Fly   136 GMVYSLIS 143
            .|:.:||:
  Rat   131 SMILALIN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 43/128 (34%)
Cnih4NP_001099451.1 Cornichon 3..130 CDD:281325 43/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.