DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and cni-1

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_506278.1 Gene:cni-1 / 179801 WormBaseID:WBGene00011648 Length:145 Species:Caenorhabditis elegans


Alignment Length:144 Identity:82/144 - (56%)
Similarity:107/144 - (74%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLL 65
            |||.|.||.|::|||...|.|||||:.||..|||:|||||||:||.:||.|:||||::|....:|
 Worm     1 MAFTFAAFCYLLALIAVGFCIFFAIYTVICVDELRTDYKNPIEQCRNLNQLILPEYIIHGTFTVL 65

  Fly    66 FLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISF 130
            |:|..:..|:..|:||..|||:.|..||||||||:|||||:|...||...:|..|||||.||:||
 Worm    66 FIFSWQLISILANLPLAFYHIYTYAKRPVMSGPGIYDPTTILNRSTLSSTLRISWIKLAFYLVSF 130

  Fly   131 FYYIYGMVYSLIST 144
            |||:|.|:|:|:::
 Worm   131 FYYLYAMIYTLVTS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 74/127 (58%)
cni-1NP_506278.1 Cornichon 7..135 CDD:281325 74/127 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161280
Domainoid 1 1.000 166 1.000 Domainoid score I2361
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4219
Inparanoid 1 1.050 182 1.000 Inparanoid score I2637
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - oto20626
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - LDO PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.