DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and CNIH3

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001309231.1 Gene:CNIH3 / 149111 HGNCID:26802 Length:188 Species:Homo sapiens


Alignment Length:133 Identity:62/133 - (46%)
Similarity:82/133 - (61%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VIAFDELKTDYKNPIDQCNS----------------LNPLVLPEYLLHIFLNLLFLFCGEWFSLC 76
            :||||||:||:|:||||||.                |..||||||.:|....::||...||.:|.
Human    56 IIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLG 120

  Fly    77 INIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSL 141
            :|:||:.||.|||.:.|..|....|||..|:..|||....:|.|.|||.||:|||||:|.|:|:|
Human   121 LNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTL 185

  Fly   142 IST 144
            :|:
Human   186 VSS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 57/122 (47%)
CNIH3NP_001309231.1 Cornichon 56..179 CDD:281325 57/122 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149942
Domainoid 1 1.000 196 1.000 Domainoid score I3119
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3613
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm41570
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.