DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and Cnih2

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_034050.1 Gene:Cnih2 / 12794 MGIID:1277225 Length:160 Species:Mus musculus


Alignment Length:159 Identity:76/159 - (47%)
Similarity:100/159 - (62%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQ----------------CNSLN 49
            |||.|.||.|::.|:..|.||||.|:|:||||||:||:||||||                |..|.
Mouse     1 MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLR 65

  Fly    50 PLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYR 114
            .||:|||.:|....|:||...||.:|.:||||:.||:|||.:||......:||..:::..|.|..
Mouse    66 KLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNY 130

  Fly   115 NMREGWIKLAVYLISFFYYIYGMVYSLIS 143
            ..:|.|.|||.||:|||||:|.|||:|:|
Mouse   131 CQKESWCKLAFYLLSFFYYLYSMVYTLVS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 66/143 (46%)
Cnih2NP_034050.1 Cornichon 7..151 CDD:397410 66/143 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839985
Domainoid 1 1.000 196 1.000 Domainoid score I3121
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3592
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52399
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm43619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.