DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and cnih3

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_002939797.1 Gene:cnih3 / 100497549 XenbaseID:XB-GENE-958010 Length:160 Species:Xenopus tropicalis


Alignment Length:160 Identity:79/160 - (49%)
Similarity:103/160 - (64%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNS----------------LN 49
            |||.|.||.|:::|:..|.||||||:|:||||||:||:||||||||.                |.
 Frog     1 MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKNPIDQCNPAHARERLRNIERICFLLR 65

  Fly    50 PLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYR 114
            .||||||.:|....::||...||.:|.:|.||:.||||||.:.|..|...:|||..|:...||..
 Frog    66 KLVLPEYSIHSLFCIMFLCAEEWLTLGLNAPLLFYHIWRYFHSPADSAELIYDPLVVMSASTLSY 130

  Fly   115 NMREGWIKLAVYLISFFYYIYGMVYSLIST 144
            ..:|.|.|||.||:|||||:|.|:|:|:|:
 Frog   131 CQKEAWCKLAFYLLSFFYYLYCMIYTLMSS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 70/143 (49%)
cnih3XP_002939797.1 Cornichon 8..151 CDD:367442 69/142 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3321
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 205 1.000 Inparanoid score I3628
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm48782
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X297
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.