DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx5 and stx5

DIOPT Version :9

Sequence 1:NP_523582.4 Gene:Syx5 / 34966 FlyBaseID:FBgn0011708 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_012809038.1 Gene:stx5 / 493353 XenbaseID:XB-GENE-959062 Length:342 Species:Xenopus tropicalis


Alignment Length:350 Identity:182/350 - (52%)
Similarity:241/350 - (68%) Gaps:33/350 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SQSNYSYPASIPTSSQFYQSKEEPQETEPEPEIFVMAARDRTGEFANAIRSLQARNITRAVNIRD 187
            ||:....|||           |.|....|.|...:|:.||||.||.:|.:|||.|.  ..|.:..
 Frog    21 SQTQVLVPAS-----------EFPVAPLPVPPADIMSCRDRTAEFISACKSLQGRQ--NGVQLSS 72

  Fly   188 PRKAKQVQSYSEFMMVARFIGKNIASTYAKLEKLTMLAKKKSLFDDRPQEIQELTYIIKGDLNAL 252
            | ....|:..|||.::|:.|||::::|::||||||:|||:||||||:..||:|||||||.|:.:|
 Frog    73 P-TLSAVKQRSEFTLMAKRIGKDLSNTFSKLEKLTILAKRKSLFDDKAAEIEELTYIIKQDIGSL 136

  Fly   253 NQQIARLQDISKDQRRHTNGKHLVSHSSNMVLALQSKLASMSTDFKQILEVRTENLKQQKTRRDQ 317
            |||||:||...: .|...:|:||.:||:.:|::|||||||||.|||.:|||||||||||::||:.
 Frog   137 NQQIAQLQSFVR-ARGSQSGRHLQTHSNTVVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREH 200

  Fly   318 FSQGPGPLAAH--TVSPSTAKQGSLLLSEENQA---VSIDMGSSDTTPLLSTQTQMAIYDDSDNY 377
            ||||...|..|  ::.|      |:||.::::.   |:|:|.|       ....|:.:.|:.|:|
 Frog   201 FSQGQVALPLHHNSLGP------SVLLQDDSRRQGDVTIEMDS-------RVSQQLQLIDEQDSY 252

  Fly   378 VQQRAETMQNIESTIVELGGIFQQLAHMVKEQEEIVERIDTNVADAELNIEAAHGEILKYFQSVS 442
            :|.||:|||||||||||||.||||||||||||||.::|||.||.|.:||:|.||.|||||||||:
 Frog   253 IQSRADTMQNIESTIVELGSIFQQLAHMVKEQEETIQRIDGNVEDTQLNVEGAHQEILKYFQSVT 317

  Fly   443 KNRWLMIKIFGVLIFFFLFFVVFMS 467
            .|||||||||.:||.||:.||||::
 Frog   318 SNRWLMIKIFLILIVFFIIFVVFLA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx5NP_523582.4 SNARE_syntaxin5 379..451 CDD:277197 56/71 (79%)
stx5XP_012809038.1 Syntaxin-5_N 43..64 CDD:371517 11/20 (55%)
COG5325 84..311 CDD:227635 132/240 (55%)
SNARE_syntaxin5 253..325 CDD:277197 55/71 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 220 1.000 Domainoid score I2581
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2381
Inparanoid 1 1.050 321 1.000 Inparanoid score I2479
OMA 1 1.010 - - QHG53826
OrthoDB 1 1.010 - - D1297427at2759
OrthoFinder 1 1.000 - - FOG0003050
OrthoInspector 1 1.000 - - oto102723
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1315
SonicParanoid 1 1.000 - - X2031
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.