DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx5 and Syx1A

DIOPT Version :9

Sequence 1:NP_523582.4 Gene:Syx5 / 34966 FlyBaseID:FBgn0011708 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster


Alignment Length:259 Identity:59/259 - (22%)
Similarity:120/259 - (46%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 KKKSLFDDRP-------QEIQELTYIIKGDLNALNQQIARL-QDISKDQRRHTNGKHLVSHSSNM 282
            ||.|.....|       ||:::|...||.:.|.:..::..: |:|.::::::.:...        
  Fly    59 KKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSAD-------- 115

  Fly   283 VLALQSKLASMSTDFKQILEVRTENLKQQKTRRDQFSQGPGPLAAH---TVSPSTAKQGSLLLSE 344
               |:.:....||..::.:||.||   ..:|:.|...:..|.:...   |..|:...:...:|.|
  Fly   116 ---LRIRKTQHSTLSRKFVEVMTE---YNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEE 174

  Fly   345 ENQAVSIDMGSSDTTPLLSTQTQMAIYDDSDNYVQQRAETMQNIESTIVELGGIFQQLAHMVKEQ 409
            .|        ||..|..:..:||.|....:|  ::.|.:.:..:|::|.||..:|..:|.:|:.|
  Fly   175 GN--------SSVFTQGIIMETQQAKQTLAD--IEARHQDIMKLETSIKELHDMFMDMAMLVESQ 229

  Fly   410 EEIVERIDTNVADAELNIEAAHGE---ILKYFQSVSKNRWLMI----KIFGVLIFFFL--FFVV 464
            .|:::||:.:|..|...::.|..:   .||| ||.::.:.:||    .:.|:|...::  :|::
  Fly   230 GEMIDRIEYHVEHAMDYVQTATQDTKKALKY-QSKARRKKIMILICLTVLGILAASYVSSYFII 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx5NP_523582.4 SNARE_syntaxin5 379..451 CDD:277197 22/78 (28%)
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 42/194 (22%)
SNARE 231..281 CDD:399038 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.