DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5861 and AT1G47640

DIOPT Version :9

Sequence 1:NP_609789.1 Gene:CG5861 / 34965 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_564509.1 Gene:AT1G47640 / 841173 AraportID:AT1G47640 Length:228 Species:Arabidopsis thaliana


Alignment Length:179 Identity:70/179 - (39%)
Similarity:102/179 - (56%) Gaps:14/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLYHFGNCVALLT--PYYFTYKYSGLSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPSS 63
            |||:||.|| |:||  |:...|..:.||||......|:|..:|:.|.|||::.||||.   ..|.
plant     1 MTLFHFFNC-AILTFGPHAVYYSATPLSEYDTLGTSVKAAVVYLATALVKLVCLATFL---QVSE 61

  Fly    64 SGEFNFFAEILRCSMDIADLLGFALILSRIPGKGHS---KLITAGLGWATAEVILSRGIMLWVGA 125
            :..|:.:.|.|:..:...|:.|....|:::..:..|   |....|||||.|:.:|.|...|||||
plant    62 TEVFDPYQEALKAMIGFIDVAGLYYALAQLTHRNISQNHKFQAVGLGWAFADSVLHRLAPLWVGA 126

  Fly   126 RGTEFSWIYILKCLESNVLLVQHITTA---TLIWLFTRHDLNKALKPLV 171
            ||.||:|.|:|:.||:|..||..|:.|   :|:||  |.:..|:|.|::
plant   127 RGLEFTWDYVLQGLEANANLVFTISLAALGSLMWL--RKNKPKSLIPII 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..157 CDD:401642 63/162 (39%)
AT1G47640NP_564509.1 DUF2053 2..161 CDD:401642 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2397
eggNOG 1 0.900 - - E1_KOG3236
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12330
Inparanoid 1 1.050 104 1.000 Inparanoid score I2143
OMA 1 1.010 - - QHG54820
OrthoDB 1 1.010 - - D1388283at2759
OrthoFinder 1 1.000 - - FOG0006016
OrthoInspector 1 1.000 - - oto3344
orthoMCL 1 0.900 - - OOG6_105654
Panther 1 1.100 - - LDO PTHR12869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4313
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.