DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5861 and Tmem147

DIOPT Version :9

Sequence 1:NP_609789.1 Gene:CG5861 / 34965 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_081491.2 Gene:Tmem147 / 69804 MGIID:1915011 Length:224 Species:Mus musculus


Alignment Length:220 Identity:108/220 - (49%)
Similarity:149/220 - (67%) Gaps:6/220 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLYHFGNCVAL-LTPYYFTYKYSGLSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPS-S 63
            |||:|||||.|| ..||:.|||.||||||.|||||||||..|:|.||.|||.|||||    |: .
Mouse     1 MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFF----PTWE 61

  Fly    64 SGEFNFFAEILRCSMDIADLLGFALILSRIPGKGHSKLITAGLGWATAEVILSRGIMLWVGARGT 128
            .|.::|..|.::.|:|:|||:|..|::||..|||..|::.|.|||||||:|:||.|.|||||||.
Mouse    62 GGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGI 126

  Fly   129 EFSWIYILKCLESNVLLVQHITTATLIWLFTRHDLNKALKPLVSLLLAVTVFKGVWLEGMLHILT 193
            ||.|.||...::||:.||.:|..:..:|:.||:||....:|.|.||:.::|:|...:|..:|:.:
Mouse   127 EFDWKYIQMSIDSNISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLFS 191

  Fly   194 IGPWLTVAVKALVAAVIGFCTLHIY 218
            :|.|..:..:|:|..::...||.:|
Mouse   192 LGSWTALLARAVVTGLLALSTLALY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..157 CDD:401642 87/156 (56%)
Tmem147NP_081491.2 DUF2053 2..158 CDD:286808 88/159 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835029
Domainoid 1 1.000 183 1.000 Domainoid score I3433
eggNOG 1 0.900 - - E1_KOG3236
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12330
Inparanoid 1 1.050 223 1.000 Inparanoid score I3516
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54820
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006016
OrthoInspector 1 1.000 - - oto94632
orthoMCL 1 0.900 - - OOG6_105654
Panther 1 1.100 - - LDO PTHR12869
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3948
SonicParanoid 1 1.000 - - X4313
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.