DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and AIM7

DIOPT Version :9

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_010348.1 Gene:AIM7 / 851635 SGDID:S000002470 Length:149 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:37/142 - (26%)
Similarity:71/142 - (50%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ISNEVLEELKKFRFSKSKNNA--ALILKVD-REKQTVVLDE-------FIDDISVDELQDTLPGH 63
            |..|...::||||.|.::.::  ||.:|:: :....:::||       .|:|:|  ||.:.||.:
Yeast     7 IGTETRNKIKKFRTSTARTDSIKALSIKIEPKPSYEIIVDEDEQEELDEIEDLS--ELAEILPDN 69

  Fly    64 QPRYVIYTYKMVHDDQRISYPMCFIFYTPRD--SQIELQMMYACTKSALQREVDLTRVYEI---- 122
            .||:|:..|.....|.....|:..:::.|..  || |.:|:||.....::.|....::.|:    
Yeast    70 SPRFVLTAYPTTTKDGFKQTPLVLVYWKPMTVVSQ-EWKMLYAGALEMIREECGTFKLIEVSSGL 133

  Fly   123 ---RELDELTEE 131
               .:::||.|:
Yeast   134 EDDSDVEELREQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 35/138 (25%)
AIM7NP_010348.1 ADF_gelsolin 7..136 CDD:417759 34/131 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345762
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1736
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54482
OrthoFinder 1 1.000 - - FOG0002926
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104464
Panther 1 1.100 - - LDO PTHR11249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1785
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.