DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and ADF4

DIOPT Version :9

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_851228.1 Gene:ADF4 / 836111 AraportID:AT5G59890 Length:139 Species:Arabidopsis thaliana


Alignment Length:125 Identity:34/125 - (27%)
Similarity:65/125 - (52%) Gaps:7/125 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KFRF--SKSKNNAALILKVDREKQTVVLDEFIDD--ISVDELQDTLPGHQPRYVIYTYKMVHDDQ 79
            |.||  .|:|.....|:....|||..|:.|.:.:  ::.::...:||..:.||.||.:..|..:.
plant    15 KLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASLPADECRYAIYDFDFVTAEN 79

  Fly    80 RISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELD--ELTEEWLKAKL 137
            .....:.||.:.|..:::..:|:||.:|...:||:|..:| |::..|  |:..:.||:::
plant    80 CQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQV-ELQATDPTEMDLDVLKSRV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 32/115 (28%)
ADF4NP_851228.1 ADF_cofilin_like 6..138 CDD:200442 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.