DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and gmfg

DIOPT Version :9

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001025651.1 Gene:gmfg / 595039 XenbaseID:XB-GENE-947192 Length:142 Species:Xenopus tropicalis


Alignment Length:138 Identity:74/138 - (53%)
Similarity:105/138 - (76%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDN-QICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQ 64
            |||: .:||:..|:.|:|:||||.|..||||:::|:|:|||.|:|:|...|||.||||:.||..|
 Frog     1 MSDSLVVCDVDPELKEKLRKFRFRKETNNAAILMKIDKEKQLVILEEEYQDISPDELQNELPERQ 65

  Fly    65 PRYVIYTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELT 129
            ||:::|:||.||:|.|||||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||...:||
 Frog    66 PRFLVYSYKYVHEDGRISYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRNTSDLT 130

  Fly   130 EEWLKAKL 137
            |:|||.:|
 Frog   131 EDWLKERL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 63/120 (53%)
gmfgNP_001025651.1 ADF_GMF-beta_like 9..130 CDD:200439 63/120 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1477747at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.