DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and gmfb

DIOPT Version :9

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001017002.1 Gene:gmfb / 549756 XenbaseID:XB-GENE-6077246 Length:142 Species:Xenopus tropicalis


Alignment Length:132 Identity:70/132 - (53%)
Similarity:101/132 - (76%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIY 70
            :||:..|::|:||||||.|..||||:|:|:|::::.|||:|..:.||.|||:|.||..|||:::|
 Frog     7 VCDVDAELVEKLKKFRFRKETNNAAIIMKIDKDRRLVVLEEEHEGISPDELKDELPERQPRFIVY 71

  Fly    71 TYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKA 135
            :||..|||.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||..::||||||..
 Frog    72 SYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLTE 136

  Fly   136 KL 137
            ||
 Frog   137 KL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 61/120 (51%)
gmfbNP_001017002.1 ADF_GMF-beta_like 9..130 CDD:200439 61/120 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37882
Inparanoid 1 1.050 158 1.000 Inparanoid score I4167
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1477747at2759
OrthoFinder 1 1.000 - - FOG0002926
OrthoInspector 1 1.000 - - otm49382
Panther 1 1.100 - - LDO PTHR11249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2749
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.