DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and GMFB

DIOPT Version :9

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_004115.1 Gene:GMFB / 2764 HGNCID:4373 Length:142 Species:Homo sapiens


Alignment Length:132 Identity:70/132 - (53%)
Similarity:104/132 - (78%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIY 70
            :||::.:::|:|:||||.|..||||:|:|:|::|:.|||||.::.||.|||:|.||..|||:::|
Human     7 VCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVY 71

  Fly    71 TYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKA 135
            :||..|||.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||..::||||||:.
Human    72 SYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLRE 136

  Fly   136 KL 137
            ||
Human   137 KL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 61/120 (51%)
GMFBNP_004115.1 ADF_GMF-beta_like 9..130 CDD:200439 61/120 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157588
Domainoid 1 1.000 148 1.000 Domainoid score I4474
eggNOG 1 0.900 - - E1_KOG1736
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37882
Inparanoid 1 1.050 159 1.000 Inparanoid score I4265
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54482
OrthoDB 1 1.010 - - D1477747at2759
OrthoFinder 1 1.000 - - FOG0002926
OrthoInspector 1 1.000 - - otm42156
orthoMCL 1 0.900 - - OOG6_104464
Panther 1 1.100 - - LDO PTHR11249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1785
SonicParanoid 1 1.000 - - X2749
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.