DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and gmf1

DIOPT Version :9

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_593581.1 Gene:gmf1 / 2542259 PomBaseID:SPAC17H9.11 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:132 Identity:41/132 - (31%)
Similarity:75/132 - (56%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDNQICDISNEVLEELKKFRFSKSKN-NAALILKVDREKQTVVLD-EFIDDISVDELQDTLPGHQ 64
            |:.::..||:..::|:.:||....|: ..|.|||||:..:.:|.| |.:|..|::|:.|.|....
pombe     3 SEARMFTISDTTMKEIDRFRLRLKKSVMYAFILKVDKATKEIVPDGEIMDLQSIEEVADELSETN 67

  Fly    65 PRYVIYTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELT 129
            ||:::.:|.....|.|:|.|:..|::.|..:..:|.|:||..|...|....:.:|:|.|:.:::|
pombe    68 PRFILVSYPTKTTDGRLSTPLFMIYWRPSATPNDLSMIYASAKVWFQDVSQVHKVFEARDSEDIT 132

  Fly   130 EE 131
            .|
pombe   133 SE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 38/122 (31%)
gmf1NP_593581.1 ADF_GMF-beta_like 9..132 CDD:200439 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I2916
eggNOG 1 0.900 - - E1_KOG1736
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I1921
OMA 1 1.010 - - QHG54482
OrthoFinder 1 1.000 - - FOG0002926
OrthoInspector 1 1.000 - - oto102024
orthoMCL 1 0.900 - - OOG6_104464
Panther 1 1.100 - - LDO PTHR11249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1785
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.