DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and TFIIIA

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001322779.1 Gene:TFIIIA / 843536 AraportID:AT1G72050 Length:427 Species:Arabidopsis thaliana


Alignment Length:361 Identity:75/361 - (20%)
Similarity:106/361 - (29%) Gaps:161/361 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QRDSDEEEPVDAKVSKRR-------------------------SRYQRKPPEEHKKRGPK--PVP 143
            :||..||..||.|.|.::                         |.:|.:..||......:  ...
plant    13 KRDMAEEAKVDVKTSAKKDIRNYLCQYCGISRSKNYLITKHIQSHHQMELEEERDDEACEVDEES 77

  Fly   144 KMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQC--SFCIQRFAQKYNLKVHERTHTGDKPFQC- 205
            ...|||.||...||..|.|.||:::|:.|:.:.|  ..|...:.:|.:|..|..||.| |.|:| 
plant    78 SSNHTCQECGAEFKKPAHLKQHMQSHSLERSFTCYVDDCAASYRRKDHLNRHLLTHKG-KLFKCP 141

  Fly   206 -EICSKQFSALGNFQAH-QKIHL-------------GVRDQVCS--------------------- 234
             |.|..:||..||...| :|.|.             |.:|..|.                     
plant   142 KENCKSEFSVQGNVGRHVKKYHSNDNRDKDNTGLGDGDKDNTCKGDDDKEKSGSGGCEKENEGNG 206

  Fly   235 -----------------------------LCQKGFYTAGDLSKHMITHTG--------------- 255
                                         .|.|.|.....|.||..:|..               
plant   207 GSGKDNNGNGDSQPAECSTGQKQVVCKEIGCGKAFKYPSQLQKHQDSHVKLDSVEAFCSEPGCMK 271

  Fly   256 -------IKNH--------HCDVCGKAFSR---RRDMRTHKLKLHPLESSTNHDIVDDDDDEAID 302
                   :|:|        :|::||....:   :|.:|||                    ||  |
plant   272 YFTNEECLKSHIRSCHQHINCEICGSKHLKKNIKRHLRTH--------------------DE--D 314

  Fly   303 TDPVGLDTLDHAHFKC--PDCDKAFDTADSLSLHFR 336
            :.|        ...||  ..|...|..|.:|..|.:
plant   315 SSP--------GEIKCEVEGCSSTFSKASNLQKHMK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 26/68 (38%)
C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
C2H2 Zn finger 177..197 CDD:275368 5/21 (24%)
zf-H2C2_2 189..213 CDD:404364 10/25 (40%)
C2H2 Zn finger 205..225 CDD:275368 9/22 (41%)
C2H2 Zn finger 233..253 CDD:275368 7/69 (10%)
zf-H2C2_2 245..270 CDD:404364 9/54 (17%)
C2H2 Zn finger 261..282 CDD:275368 7/23 (30%)
C2H2 Zn finger 318..338 CDD:275368 6/21 (29%)
TFIIIANP_001322779.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.