DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and ZNF668

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001166140.1 Gene:ZNF668 / 79759 HGNCID:25821 Length:642 Species:Homo sapiens


Alignment Length:269 Identity:80/269 - (29%)
Similarity:116/269 - (43%) Gaps:62/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PQRDSDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTH 169
            |:.::..||....|||                 |....|: |:.|..|.|::|...:|..|.|:|
Human    83 PETEAKAEEASGEKVS-----------------GSAAKPR-PYACPLCPKAYKTAPELRSHGRSH 129

  Fly   170 TGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCS 234
            |||||:.|..|.:||.|...|:||..:|.|:.||:|..|.|.:.||...:.||:.|.|.|...|:
Human   130 TGEKPFPCPECGRRFMQPVCLRVHLASHAGELPFRCAHCPKAYGALSKLKIHQRGHTGERPYACA 194

  Fly   235 LCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDE 299
            .|.|.|.......||..||.|::.:.|:.||||::..:|:|.|: :.|..|..            
Human   195 DCGKSFADPSVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHE-RSHTGERP------------ 246

  Fly   300 AIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAANNNLLNLPLPPAPP--------MS 356
                            |.|.:|.|:|..:.||:.|.|.|||..       |...|        :|
Human   247 ----------------FLCSECGKSFSRSSSLTCHQRIHAAQK-------PYRCPACGKGFTQLS 288

  Fly   357 HHYHHDALH 365
            .:..|:..|
Human   289 SYQSHERTH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 28/64 (44%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
zf-H2C2_2 189..213 CDD:404364 10/23 (43%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 10/24 (42%)
C2H2 Zn finger 261..282 CDD:275368 8/20 (40%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
ZNF668NP_001166140.1 COG5048 103..437 CDD:227381 73/232 (31%)
C2H2 Zn finger 109..129 CDD:275370 7/19 (37%)
zf-H2C2_2 121..144 CDD:290200 11/22 (50%)
C2H2 Zn finger 137..157 CDD:275368 8/19 (42%)
C2H2 Zn finger 165..185 CDD:275368 7/19 (37%)
zf-H2C2_2 178..201 CDD:290200 8/22 (36%)
C2H2 Zn finger 193..213 CDD:275368 6/19 (32%)
C2H2 Zn finger 221..241 CDD:275368 8/20 (40%)
zf-H2C2_2 233..258 CDD:290200 10/53 (19%)
C2H2 Zn finger 249..269 CDD:275368 8/19 (42%)
COG5048 271..618 CDD:227381 6/34 (18%)
C2H2 Zn finger 277..297 CDD:275368 3/19 (16%)
zf-H2C2_2 289..313 CDD:290200 2/9 (22%)
C2H2 Zn finger 305..325 CDD:275368
zf-H2C2_2 317..342 CDD:290200
C2H2 Zn finger 333..353 CDD:275368
zf-H2C2_2 345..369 CDD:290200
C2H2 Zn finger 361..381 CDD:275368
zf-H2C2_2 373..397 CDD:290200
C2H2 Zn finger 389..409 CDD:275368
zf-H2C2_2 401..425 CDD:290200
C2H2 Zn finger 417..437 CDD:275368
C2H2 Zn finger 541..561 CDD:275368
zf-H2C2_2 554..577 CDD:290200
C2H2 Zn finger 569..589 CDD:275368
zf-H2C2_2 582..606 CDD:290200
C2H2 Zn finger 597..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.