DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and ZNF70

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_068735.1 Gene:ZNF70 / 7621 HGNCID:13140 Length:446 Species:Homo sapiens


Alignment Length:332 Identity:91/332 - (27%)
Similarity:133/332 - (40%) Gaps:82/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEK 173
            |:|..|.|...:.|.......|   |:    .|.|..|:.|.||.|:|...:.|.:|:..|||||
Human   109 SEEPSPCDCAETDRGDSGPNAP---HR----TPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEK 166

  Fly   174 PYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQK 238
            ||:|..|.:.|:|..:|..|:..|||:||::|..|.|.|........|||||.|.|...|..|.|
Human   167 PYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGK 231

  Fly   239 GFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAIDT 303
            .|..:..|.||...|||.:.:.|..|||:|::...:..|: |:|.|:.....|:           
Human   232 DFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHR-KIHTLKKPHECDL----------- 284

  Fly   304 DPVGLDTLDHAH-------------FKCPDCDKAFDTADSLSLHFRTH---------------AA 340
              .|......:|             :||.:|.|||..:.:|..|.:||               :.
Human   285 --CGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQ 347

  Fly   341 NNNLLNLPLPPAPPMSHHYHHDALHHLGPPNPATQMGMAAMAHMLAPPPPPPPTPSEGRYTMLHH 405
            :::|:              .|..:|....|....|.| .|..|..|               ::.|
Human   348 SSSLI--------------EHQRIHTGEKPYECCQCG-KAFCHSSA---------------LIQH 382

  Fly   406 TAAQRLH 412
               ||:|
Human   383 ---QRIH 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 28/64 (44%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
zf-H2C2_2 189..213 CDD:404364 10/23 (43%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
zf-H2C2_2 245..270 CDD:404364 11/24 (46%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
ZNF70NP_068735.1 C2H2 Zn finger 92..108 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..138 7/30 (23%)
COG5048 138..442 CDD:227381 82/296 (28%)
C2H2 Zn finger 142..162 CDD:275368 7/19 (37%)
C2H2 Zn finger 170..190 CDD:275368 6/19 (32%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
C2H2 Zn finger 254..274 CDD:275368 7/20 (35%)
C2H2 Zn finger 282..302 CDD:275368 3/32 (9%)
C2H2 Zn finger 310..330 CDD:275368 7/19 (37%)
C2H2 Zn finger 338..358 CDD:275368 2/33 (6%)
C2H2 Zn finger 366..386 CDD:275368 8/38 (21%)
C2H2 Zn finger 394..413 CDD:275368
C2H2 Zn finger 421..441 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.