Sequence 1: | NP_609786.2 | Gene: | CG17328 / 34962 | FlyBaseID: | FBgn0028895 | Length: | 413 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079600.1 | Gene: | Zfp524 / 66056 | MGIID: | 1916740 | Length: | 321 | Species: | Mus musculus |
Alignment Length: | 221 | Identity: | 60/221 - (27%) |
---|---|---|---|
Similarity: | 95/221 - (42%) | Gaps: | 34/221 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 ATNTDFVEKPLLPQR-----DSDEEEPVDAKVSKRRSR------YQRKP---PEEHKKRGPK--P 141
Fly 142 VPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCE 206
Fly 207 ICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRR 271
Fly 272 RDMRTHKLKLHPLESSTNHDIVDDDD 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17328 | NP_609786.2 | zf-AD | 8..80 | CDD:214871 | |
COG5048 | 146..>211 | CDD:227381 | 21/64 (33%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 189..213 | CDD:404364 | 8/23 (35%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 245..270 | CDD:404364 | 5/24 (21%) | ||
C2H2 Zn finger | 261..282 | CDD:275368 | 1/20 (5%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | |||
Zfp524 | NP_079600.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..80 | 11/40 (28%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 86..105 | 5/18 (28%) | |||
COG5048 | <102..218 | CDD:227381 | 36/121 (30%) | ||
C2H2 Zn finger | 111..131 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 139..159 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 167..187 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 195..216 | CDD:275368 | 7/26 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 248..321 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |