DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and PRDM15

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011527985.1 Gene:PRDM15 / 63977 HGNCID:13999 Length:1441 Species:Homo sapiens


Alignment Length:417 Identity:108/417 - (25%)
Similarity:154/417 - (36%) Gaps:106/417 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ICNNCIYRLGVA-----FHFKQECENSDLRLRQYLGILESWRQDAATNTDFVEKPLLPQRDSDEE 112
            ||....:|:.|.     .|||......|.:..:::|.:....::...|:|          :|.:.
Human   867 ICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKIGISSEENDDNSD----------ESADS 921

  Fly   113 EPVDAKVSKRR--------SRYQRKPPEEHKKRG---------------------------PKP- 141
            ||  .|.|.:|        ..|.:...|.||::|                           |.| 
Human   922 EP--HKYSCKRCQLTFGRGKEYLKHIMEVHKEKGYGCSICNRRFALKATYHAHMVIHRENLPDPN 984

  Fly   142 VPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCE 206
            |.|..|.|..|.:.|..|..|.:|...|||.|.:.|..|.:.||:|..||.|.|.|...:.:.|.
Human   985 VQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCGKSFARKDMLKEHMRVHDNVREYLCA 1049

  Fly   207 ICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRR 271
            .|.|........:.|.|:|.|:::..|..|.:.|....::.||...|||||:..|::|||.||.|
Human  1050 ECGKGMKTKHALRHHMKLHKGIKEYECKECHRRFAQKVNMLKHCKRHTGIKDFMCELCGKTFSER 1114

  Fly   272 RDMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFR 336
            ..|.|||| :|                      .||      ..:.|..|||.:.|...|..|.:
Human  1115 NTMETHKL-IH----------------------TVG------KQWTCSVCDKKYVTEYMLQKHVQ 1150

  Fly   337 -TH----AANNNLLNLPLPPAPPMSHHYHH----------DALHHLGPPNPATQMGMAAMAHMLA 386
             ||    |.:..|....:.....||.|...          |.|.||    |.|....|:...::.
Human  1151 LTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHL----PETTTIDASSIGIVQ 1211

  Fly   387 PP-PPPPPTPSEGRYTMLHHTAAQRLH 412
            |. .......:||:    |..||:|.|
Human  1212 PELTLEQEDLAEGK----HGKAAKRSH 1234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 8/31 (26%)
COG5048 146..>211 CDD:227381 23/64 (36%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 9/19 (47%)
zf-H2C2_2 189..213 CDD:404364 8/23 (35%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
zf-H2C2_2 245..270 CDD:404364 12/24 (50%)
C2H2 Zn finger 261..282 CDD:275368 12/20 (60%)
C2H2 Zn finger 318..338 CDD:275368 7/20 (35%)
PRDM15XP_011527985.1 SET 349..465 CDD:214614
GAGA_bind <515..>580 CDD:283799
COG5048 663..1125 CDD:227381 77/292 (26%)
zf-C2H2 672..694 CDD:278523
C2H2 Zn finger 674..694 CDD:275368
C2H2 Zn finger 701..722 CDD:275368
C2H2 Zn finger 735..751 CDD:275368
C2H2 Zn finger 789..809 CDD:275368
C2H2 Zn finger 838..858 CDD:275368
C2H2 Zn finger 865..885 CDD:275368 4/17 (24%)
C2H2 Zn finger 928..949 CDD:275370 3/20 (15%)
C2H2 Zn finger 956..976 CDD:275368 0/19 (0%)
C2H2 Zn finger 992..1012 CDD:275368 6/19 (32%)
zf-H2C2_2 1004..1029 CDD:290200 9/24 (38%)
C2H2 Zn finger 1020..1040 CDD:275368 9/19 (47%)
C2H2 Zn finger 1048..1068 CDD:275368 5/19 (26%)
zf-H2C2_2 1060..1085 CDD:290200 7/24 (29%)
C2H2 Zn finger 1076..1096 CDD:275368 5/19 (26%)
C2H2 Zn finger 1104..1124 CDD:275368 12/20 (60%)
C2H2 Zn finger 1132..1153 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.