DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG12071

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster


Alignment Length:337 Identity:64/337 - (18%)
Similarity:106/337 - (31%) Gaps:138/337 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 KSFKCIAQLTQHIR----THTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSA 214
            |:.:.:.|.:..:|    :.:..|.::|:.|.:..|:|..|.:|.|.|||:||:.||:|:|.|:.
  Fly   160 KALQQVQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFAR 224

  Fly   215 LGNFQAH-------------------------------------QKIHLGVRDQVCSLCQKGFYT 242
            ......|                                     |.:.|.::.|...:.      
  Fly   225 RDKLVIHMNKFKHVTPTNIAPLGKRLNNMVKKKEQPDPPPEDNKQSLELQLQQQAVQVA------ 283

  Fly   243 AGDLSKHMITHTG----------IKNHH-------CDVCGKAFSRRRDMRTHKLKLHPLESSTNH 290
                ::::|..:.          |..||       |::||:.||.|.:...| .|.| ||.....
  Fly   284 ----AQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIH-AKSH-LEYXQPE 342

  Fly   291 DIVDDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAANNNLLNLPLPPAPPM 355
            .:|      |..|.|                     .|.:..:..:|.::||             
  Fly   343 RLV------AESTKP---------------------AAAAAGVIAKTTSSNN------------- 367

  Fly   356 SHHYHHDALHHLGPPNPATQMGMAAMA----------------HMLAPPPPPPPTPSEGRYTMLH 404
            |.:|..||..:        |:.|.|.|                |.....|...|...:.:.....
  Fly   368 SRNYQMDANQN--------QIQMEAQARKQKIIIQNQMILNASHQQQQQPQQHPQQQQHQQQQQQ 424

  Fly   405 HTA----AQRLH 412
            |.|    |.|.|
  Fly   425 HVAHGKKAARKH 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 19/60 (32%)
C2H2 Zn finger 149..169 CDD:275368 3/18 (17%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 12/23 (52%)
C2H2 Zn finger 205..225 CDD:275368 7/56 (13%)
C2H2 Zn finger 233..253 CDD:275368 1/19 (5%)
zf-H2C2_2 245..270 CDD:404364 8/41 (20%)
C2H2 Zn finger 261..282 CDD:275368 8/20 (40%)
C2H2 Zn finger 318..338 CDD:275368 1/19 (5%)
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 7/21 (33%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
zf-H2C2_2 200..224 CDD:290200 13/23 (57%)
C2H2 Zn finger 215..232 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.