DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and Sry-beta

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:326 Identity:72/326 - (22%)
Similarity:124/326 - (38%) Gaps:77/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LP-SVICNNCIYRLGVAFHF----------KQECENSDLRLRQYLGILESWRQDAATNTDFVEKP 102
            || |..|.:|:..|   |::          :::..::.|..||..|..|: :|.||.... |:.|
  Fly    53 LPNSAACRDCLEYL---FNYDRLVRNLSQVQRQIADALLGCRQVEGKAET-KQQAAKRAR-VQVP 112

  Fly   103 LL----------PQRDSDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPKPVPKMPHT--------- 148
            ..          |:|...||:..:        .:.::...:.:.:..:|...||.:         
  Fly   113 AFKIVQATALKEPERQPGEEDECE--------EFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETT 169

  Fly   149 ---CYECHKSFKCIAQLTQHIRTHTGEKPYQ--CSFCIQRFAQKYNLKVHERTHTGDKPFQCEIC 208
               |:.|.:.|.....|.:||:..|.:|..|  |:.|..:......|.:|...|.|....:|..|
  Fly   170 EIPCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYC 234

  Fly   209 SKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNH-HCDVCGKAFSRRR 272
            .|:||...|...|.::|...:...|..|.:.|..:..:..|::.|...:|. .|:||.:.|..:|
  Fly   235 DKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKR 299

  Fly   273 DMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRT 337
            ..: |.|:.|                           ..|...:.||||:|:|....:|.:|.|.
  Fly   300 TYK-HHLRTH---------------------------QTDRPRYPCPDCEKSFVDKYTLKVHKRV 336

  Fly   338 H 338
            |
  Fly   337 H 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 8/41 (20%)
COG5048 146..>211 CDD:227381 18/78 (23%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 4/19 (21%)
zf-H2C2_2 189..213 CDD:404364 7/23 (30%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 4/19 (21%)
zf-H2C2_2 245..270 CDD:404364 7/25 (28%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368 9/19 (47%)
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
C2H2 Zn finger 231..251 CDD:275368 7/19 (37%)
C2H2 Zn finger 259..308 CDD:275368 13/49 (27%)
C2H2 Zn finger 288..303 CDD:275370 5/15 (33%)
zf-C2H2 315..337 CDD:278523 9/21 (43%)
C2H2 Zn finger 317..337 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.