DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG31365

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:627 Identity:108/627 - (17%)
Similarity:169/627 - (26%) Gaps:334/627 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ICRVCLEELHPVTSIYSTDFAMMP-SVMLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFKQEC 71
            :||:||:|.....:|:..|...:. .|.||.|..:....||.||..||..|.|:|..:|.|:|.|
  Fly    13 LCRLCLKEHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFLFRQRC 77

  Fly    72 ENSDLRLRQYLGIL-----------------------------------------ESWRQD---- 91
            :.::.:||:::.:|                                         |.||:|    
  Fly    78 QWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEE 142

  Fly    92 -----------------AATNTDF-----------VEKPL------------------------- 103
                             |...|:.           |.|.|                         
  Fly   143 QAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQL 207

  Fly   104 ----------------------------------------------LPQR--------------- 107
                                                          ||:|               
  Fly   208 AMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANLKATEAR 272

  Fly   108 ---------------------------DSDEEEPVDAKVSKR----------------------- 122
                                       :.|||.|.::....|                       
  Fly   273 KDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIYIINSA 337

  Fly   123 ----------------------------RSRYQRKPPEE-------------------------- 133
                                        ..::..:.|||                          
  Fly   338 SSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENV 402

  Fly   134 ----------------HKKRGPKPVPKMPHTC--------------YECH--------------- 153
                            .:||..:.|.|...:|              ::||               
  Fly   403 IIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRH 467

  Fly   154 --------KSFK--------------CIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERT 196
                    ||.|              |.:.|.:|:..|||.||::||.|...|:|:..||.|..|
  Fly   468 HNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDT 532

  Fly   197 HTGDKPFQCEICSKQFSALGNFQAH-QKIHLG-VRDQVCSLCQKGFYTAGDLSKHMITHTGIKNH 259
            |||.|..||..||..|:...|.|.| .::|:| .|...|.||.:.|.....||:|::||.|:. .
  Fly   533 HTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-F 596

  Fly   260 HCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAI 301
            .|..||:.|:.|..::.|...:|.:::.....|.:.::.:|:
  Fly   597 SCKQCGRQFNDRSAVQRHVTTMHKVKNKLTDYISETNEFQAV 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 25/72 (35%)
COG5048 146..>211 CDD:227381 31/115 (27%)
C2H2 Zn finger 149..169 CDD:275368 9/70 (13%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
zf-H2C2_2 189..213 CDD:404364 12/23 (52%)
C2H2 Zn finger 205..225 CDD:275368 7/20 (35%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
zf-H2C2_2 245..270 CDD:404364 10/24 (42%)
C2H2 Zn finger 261..282 CDD:275368 6/20 (30%)
C2H2 Zn finger 318..338 CDD:275368
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 25/72 (35%)
vATP-synt_E 109..>244 CDD:304907 9/134 (7%)
RRF <161..222 CDD:294170 4/60 (7%)
zf-C2H2_8 454..530 CDD:292531 18/75 (24%)
C2H2 Zn finger 485..505 CDD:275368 3/19 (16%)
zf-H2C2_2 497..522 CDD:290200 11/24 (46%)
C2H2 Zn finger 513..533 CDD:275368 8/19 (42%)
zf-H2C2_2 526..550 CDD:290200 13/23 (57%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.