DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG4936

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:505 Identity:103/505 - (20%)
Similarity:161/505 - (31%) Gaps:209/505 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ICRVCLEE-LHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFKQEC 71
            :|||||:: ..|:.||::.|.....:.|:.:|..:.:.:.|..|..||..|...|.:||.|::.|
  Fly    22 VCRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETC 86

  Fly    72 ENSDLRLRQYLGILESWRQ---------------------------------------------D 91
            :.|...|||::|.:|..::                                             |
  Fly    87 QRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEAD 151

  Fly    92 AATNT------DFVEKPLLPQRDSD---------------------------------------- 110
            .|..|      |.:|..:|.:.:.|                                        
  Fly   152 DAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGIIEEVYDVYETYEGDLIPDQGYDHEM 216

  Fly   111 ---------------------------------------EEEPVDAK----------VSKRRSRY 126
                                                   |||.|.:|          .:|||...
  Fly   217 ADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRVNP 281

  Fly   127 QRKP--------------------------------------------------PEEH---KKRG 138
            :|..                                                  ..:|   |.:|
  Fly   282 RRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKTKG 346

  Fly   139 PKPV-----PKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHT 198
            ...:     .:..:.|..|...:...::||:||:.|:|.||::|..|...|||...|..|..|||
  Fly   347 GHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNTHT 411

  Fly   199 GDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDV 263
            |::|::|..|...|:.|.....|.:||...|...|.:|.|.|.....|..|.:.|||.|.|.|||
  Fly   412 GNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVCDV 476

  Fly   264 CGKAFSRRRDMRTHKLKLHPLESSTNHD----IVDDDDDEAIDTDPVGLD 309
            |||.|.:...:|.|:: :|.....:..:    :|..|     ..:.||||
  Fly   477 CGKGFPQAYKLRNHRV-IHERRGQSARESVAGLVSYD-----TANIVGLD 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 23/72 (32%)
COG5048 146..>211 CDD:227381 24/64 (38%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 9/23 (39%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 14/24 (58%)
C2H2 Zn finger 261..282 CDD:275368 9/20 (45%)
C2H2 Zn finger 318..338 CDD:275368
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 23/72 (32%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 11/23 (48%)
COG5048 386..>447 CDD:227381 22/60 (37%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 9/22 (41%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-H2C2_2 432..455 CDD:290200 8/22 (36%)
C2H2 Zn finger 446..466 CDD:275368 6/19 (32%)
zf-H2C2_2 459..481 CDD:290200 13/21 (62%)
C2H2 Zn finger 474..494 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.