DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG7691

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:202 Identity:58/202 - (28%)
Similarity:78/202 - (38%) Gaps:39/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DGLPSVICNNCIYRLGV-----------------AFHFKQECENSD----LRLRQYLGILESWRQ 90
            |.:|.|:......|||:                 .:..|...|:.|    .|....:||:....:
  Fly    77 DDIPIVVRREMEERLGIQLMSVLPITESSLLSHTIWELKMPGESFDSIPKTRNGIKVGIITVTAE 141

  Fly    91 DAATNTDFVEK-PLLPQRDSDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPKPVPKMPHTCYECHK 154
            ...|.|....| |:|      ....|.:.:.:.....|||.||   ||..|.|... ..|.:|.|
  Fly   142 SKQTRTKLKRKGPIL------ANVTVPSNIVEIPPIQQRKMPE---KRRLKRVGGQ-FECIDCDK 196

  Fly   155 SFKCIAQLTQHIRTHTGEKPYQC--SFCIQRFAQKYNLKVHERT---HTGDKPFQCEICSKQFSA 214
            .|.....||.|.||||||||:.|  ..|.:.|:.:.||:.|:||   |  :...||..|.|.||.
  Fly   197 KFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHH--EWQHQCGQCGKYFSQ 259

  Fly   215 LGNFQAH 221
            ......|
  Fly   260 FSYLNRH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 10/53 (19%)
COG5048 146..>211 CDD:227381 27/69 (39%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
C2H2 Zn finger 177..197 CDD:275368 8/24 (33%)
zf-H2C2_2 189..213 CDD:404364 10/26 (38%)
C2H2 Zn finger 205..225 CDD:275368 6/17 (35%)
C2H2 Zn finger 233..253 CDD:275368
zf-H2C2_2 245..270 CDD:404364
C2H2 Zn finger 261..282 CDD:275368
C2H2 Zn finger 318..338 CDD:275368
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 31/82 (38%)
C2H2 Zn finger 191..211 CDD:275368 8/19 (42%)
zf-H2C2_2 203..229 CDD:290200 13/25 (52%)
C2H2 Zn finger 219..244 CDD:275368 8/24 (33%)
C2H2 Zn finger 250..266 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.