DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and Odj

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster


Alignment Length:431 Identity:97/431 - (22%)
Similarity:145/431 - (33%) Gaps:151/431 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRVCLEEL---HPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFKQE 70
            ||:|.|.:   ||.......:..:  .:.:.|...:.:...:.||..||..|:..|..|..|:|.
  Fly     5 CRICGERIFTPHPKNIFEKRNHRI--RMAIEQITGLEIVLENMLPQHICACCLLDLTQAVAFRQR 67

  Fly    71 CENSDLRLRQYLG--------------------ILESWRQDAATNT------------------D 97
            |..:...|.|.:.                    :|:....|...:|                  |
  Fly    68 CLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTEDDKELLDDDKDLMDDDKD 132

  Fly    98 FV--EKPLL---------------PQRDSDEEEPVDAKVSKRRSRYQRK------PPEEH----K 135
            |:  |||:|               |.|.|..     .:|.:.|.....|      ||.||    :
  Fly   133 FLEDEKPILRYPPAKKIRIEDQNFPNRQSPR-----VRVKRLRVPVVEKADSPPPPPREHVRKPR 192

  Fly   136 KRGPKPV-------------------------PKMPH-----TCYECHKSFKCIAQLTQHIRT-H 169
            ||.|||.                         .|:.|     :|.||.:.|..:..|..|||. |
  Fly   193 KRRPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEKFSCDECGRKFYTMPLLRLHIRVHH 257

  Fly   170 TGEKPYQCSFCIQRFAQKYNLKVHER-THTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQ-- 231
            .|||||.|.||...||...:...||| .|..:....|:||.|:|::......|::.|..  ||  
  Fly   258 KGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGRLKHEEGHKS--DQPD 320

  Fly   232 --VCSLCQKGFYTAGDLSKHMITHTGIKNHH--------------------CDVCGKAFSRRRDM 274
              :|..|.|.|..|..|.:|..|    |.|.                    .:..|.....:.:|
  Fly   321 VHICLTCNKEFKEAQFLHRHYST----KYHRKRVNLLVNGPKEEFQSEVDPAEFPGYMEEGQAEM 381

  Fly   275 RTHKLKLHPL------ESSTNHDIVDDDD--------DEAI 301
            ..::.:|..:      |...:|:::.|:|        :|||
  Fly   382 EDNQAELDVMLDNIDEEQYEDHEVLQDEDANFEDFEYEEAI 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 18/73 (25%)
COG5048 146..>211 CDD:227381 27/71 (38%)
C2H2 Zn finger 149..169 CDD:275368 8/20 (40%)
C2H2 Zn finger 177..197 CDD:275368 8/20 (40%)
zf-H2C2_2 189..213 CDD:404364 8/24 (33%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 233..253 CDD:275368 7/19 (37%)
zf-H2C2_2 245..270 CDD:404364 6/44 (14%)
C2H2 Zn finger 261..282 CDD:275368 2/20 (10%)
C2H2 Zn finger 318..338 CDD:275368
OdjNP_650661.1 zf-AD 5..77 CDD:214871 18/73 (25%)
COG5048 <202..343 CDD:227381 41/142 (29%)
C2H2 Zn finger 209..229 CDD:275368 1/19 (5%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 249..274 CDD:290200 14/24 (58%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 3/15 (20%)
zf-C2H2_jaz 322..347 CDD:288983 9/28 (32%)
C2H2 Zn finger 324..343 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.