DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG17802

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650659.2 Gene:CG17802 / 42143 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster


Alignment Length:246 Identity:64/246 - (26%)
Similarity:106/246 - (43%) Gaps:51/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QECENSDLRLRQYLGILESWRQDAATNTDFVEKPLLPQRDSDE-------------EEPVDAKVS 120
            ||||.|           :...:::..|.:..|:   .|.|.||             :...|.:.:
  Fly   184 QECEES-----------QPDEEESQQNEEDEEE---SQEDDDELWQNEDGDSDTDADSMSDIEAT 234

  Fly   121 KRRSRY--QRKPPEEHKKRGP---------KPVPK--------MPHTCYECHKSFKCIAQLTQHI 166
            .|:|..  .:||..::.||..         ||..|        ..|.|..|.|.|........|:
  Fly   235 SRQSALDEDKKPRRKYTKRSSPKNDDTDFLKPAKKKRKTYISQKVHICDHCGKKFTDKGNFNLHV 299

  Fly   167 RTHTGEKPYQCSFCIQRFAQKYNLKVHERT-HTGDKPFQCEICSKQFSALGNFQAHQ-KIHLG-- 227
            ..|:|.||::|..|.|:...:|.|.:|.|. |.|:||:.|:.|.::|........|: ::|..  
  Fly   300 LRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMRSRHENRVHRNKK 364

  Fly   228 -VRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTH 277
             .::..|:.|.|.:.:....:||.:.|||.:|.||:||..:|:|..:::||
  Fly   365 TPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 5/10 (50%)
COG5048 146..>211 CDD:227381 23/65 (35%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 7/20 (35%)
zf-H2C2_2 189..213 CDD:404364 9/24 (38%)
C2H2 Zn finger 205..225 CDD:275368 4/20 (20%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
zf-H2C2_2 245..270 CDD:404364 11/24 (46%)
C2H2 Zn finger 261..282 CDD:275368 7/17 (41%)
C2H2 Zn finger 318..338 CDD:275368
CG17802NP_650659.2 zf-AD 4..74 CDD:285071
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
C2H2 Zn finger 310..331 CDD:275368 7/20 (35%)
C2H2 Zn finger 339..360 CDD:275368 4/20 (20%)
C2H2 Zn finger 371..388 CDD:275370 4/16 (25%)
zf-met 398..421 CDD:289631 8/18 (44%)
C2H2 Zn finger 399..417 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.