DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG6654

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:637 Identity:114/637 - (17%)
Similarity:177/637 - (27%) Gaps:324/637 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIHKICRVCLEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFK 68
            ::.|||..||....|:.|||........:.|:.:..|.:..:.|.||..:|.:|:..:...:.||
  Fly     2 DVDKICLTCLSSTGPLLSIYDGGSGSCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYTFK 66

  Fly    69 QECENSDLRLRQYL--GILE----------------------SW---------RQDAATNTDF-- 98
            .:||||...|||.|  .:.|                      ||         :.||.|.||.  
  Fly    67 IKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQ 131

  Fly    99 ------------------------------VEK-------------------------------- 101
                                          |||                                
  Fly   132 NTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDH 196

  Fly   102 --------------------------------------PLLPQRDSDEEE-PVDAKVSKRRSRYQ 127
                                                  .||.|:::|:.: ||.:|...|....:
  Fly   197 ELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKE 261

  Fly   128 RKP----------------------------PEEHK--------------------KRGPKPVPK 144
            :.|                            |::|:                    ..|....|:
  Fly   262 QVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPSTTSGAATTPE 326

  Fly   145 MPHTCYEC--------------------HKSFKC------------------------------- 158
            :.:.|..|                    ::::||                               
  Fly   327 LKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIR 391

  Fly   159 --------------------------------IAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLK 191
                                            ::.|..|:|.||||||:.|:.|.:.|.|..||:
  Fly   392 CDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLR 456

  Fly   192 VHE----------------------------RTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGV 228
            .|:                            |||||||||:||:|..:|:...:...|::.|.|.
  Fly   457 QHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGE 521

  Fly   229 RDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIV 293
            |...|.||...|.....|..|..||||.:.:.|..|.|.|::|.|.:.|: :.|           
  Fly   522 RPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQ-RTH----------- 574

  Fly   294 DDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAANNNLL 345
               ..|.|              :.||.|::.|.:...:..|...|..::..|
  Fly   575 ---QGERI--------------YICPVCNEEFKSMPEMRSHLAGHEQHDKRL 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 22/71 (31%)
COG5048 146..>211 CDD:227381 32/175 (18%)
C2H2 Zn finger 149..169 CDD:275368 7/102 (7%)
C2H2 Zn finger 177..197 CDD:275368 8/47 (17%)
zf-H2C2_2 189..213 CDD:404364 15/51 (29%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 10/24 (42%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 23/72 (32%)
C2H2 Zn finger 331..354 CDD:275368 2/22 (9%)
COG5048 <357..570 CDD:227381 51/212 (24%)
C2H2 Zn finger 360..380 CDD:275368 1/19 (5%)
C2H2 Zn finger 385..406 CDD:275370 0/20 (0%)
C2H2 Zn finger 414..434 CDD:275368 3/19 (16%)
zf-H2C2_2 427..451 CDD:290200 12/23 (52%)
C2H2 Zn finger 442..490 CDD:275368 8/47 (17%)
C2H2 Zn finger 470..487 CDD:275368 0/16 (0%)
zf-H2C2_2 482..507 CDD:290200 13/24 (54%)
C2H2 Zn finger 498..518 CDD:275368 5/19 (26%)
zf-H2C2_2 510..534 CDD:290200 7/23 (30%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 10/23 (43%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.