DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG6813

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:306 Identity:79/306 - (25%)
Similarity:123/306 - (40%) Gaps:74/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRVC-----------------LEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSVICNN 56
            ||:|                 :.::|.:|.:.            :.|.|       .:...:|..
  Fly     6 CRICSRSDAPIDLFGPGNGHLVRQIHSITGVE------------LSCKK-------EISGQMCTT 51

  Fly    57 CIYRLGVAFHFKQECENSDLRLRQYLGILESWRQDAATN-------------TDFVEKPLLPQRD 108
            |:..|..|..|:|.|..::   :|.|..:|...:|.:|:             ::..|..|.|: .
  Fly    52 CLDNLQAAIKFRQRCIIAE---KQNLERIECDSKDCSTDPIIYEDIDDNQIESELDESILCPE-V 112

  Fly   109 SDEEEPVDAKVSKRRSRYQRKPPEEHKK-----RGPKPVPKMPHTCYECHKSFKCIAQLTQHIRT 168
            .|...|...|||...|.       .|:|     .|       |:.|.:|.:.....:...:|...
  Fly   113 KDLPMPSAEKVSAPTSL-------NHQKSIGGGTG-------PYVCPDCGRIINNKSNFQEHTLR 163

  Fly   169 HTGEKPYQCSF--CIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQ 231
            |||.|.:.|.|  |.:.||.:..|..|.|.|||::|:.|..|.::||:.|..|.|.:.|...|..
  Fly   164 HTGIKNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRY 228

  Fly   232 VCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTH 277
            .|..|:|.|.::|.|.||.:.|...:||:|.||.|.|.|...:.||
  Fly   229 ECDTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 14/87 (16%)
COG5048 146..>211 CDD:227381 22/66 (33%)
C2H2 Zn finger 149..169 CDD:275368 3/19 (16%)
C2H2 Zn finger 177..197 CDD:275368 8/21 (38%)
zf-H2C2_2 189..213 CDD:404364 9/23 (39%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
zf-H2C2_2 245..270 CDD:404364 11/24 (46%)
C2H2 Zn finger 261..282 CDD:275368 8/17 (47%)
C2H2 Zn finger 318..338 CDD:275368
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071 16/91 (18%)
C2H2 Zn finger 144..164 CDD:275368 3/19 (16%)
C2H2 Zn finger 172..194 CDD:275368 8/21 (38%)
zf-H2C2_2 186..211 CDD:290200 10/24 (42%)
UFD2 <256..>294 CDD:227443 9/19 (47%)
C2H2 Zn finger 258..280 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.