DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG8301

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster


Alignment Length:467 Identity:98/467 - (20%)
Similarity:157/467 - (33%) Gaps:147/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRVCLEELHPVTSIYSTDFA---------------MMPSVML---MQCA--KIRVFKTDGLPSVI 53
            ||.|      ..|::..||.               ..||.|.   :|.|  .:::...||||..|
  Fly     4 CRTC------AISMFVCDFENGSNNSHFLDLHHPNCWPSEMAQIRLQFANWNLKISPNDGLPQKI 62

  Fly    54 CNNCIYRLGVAFHFKQECENSDLRLRQ-YLGI--------------LESWRQDAATNTD------ 97
            |::|..:......|:..|:.:.|:|.. |..|              ||...:...|.|.      
  Fly    63 CSDCFTKFCSINAFRLACQEAQLKLSHIYDKIDASSLEDDEIGQEDLEPAEEHQETETTKPTTTV 127

  Fly    98 ----------------FVEKPLLPQRDSDEEEPVDAKVSKRRSRYQRK----------PPE---- 132
                            ||:...:.:.:.:|||      .:::.:|..:          ||:    
  Fly   128 SAETQPNNTASDPIEIFVDAVDIDEAEEEEEE------EEQQQQYDEEVEEPITDESAPPQLTIS 186

  Fly   133 --------------------EHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQC 177
                                ||......  |:.|:.|.||...|:..|..|.|:::...||.:.|
  Fly   187 YACKFCLRPQENYQLQQLLLEHINASHD--PEQPYNCPECEARFQDAASRTVHLKSSHVEKQHAC 249

  Fly   178 SFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVC--SLCQKGF 240
            ..|.:::..::||:.|...:..:..|:|.:|.|:|....:...|.|.|...|...|  |.|::.|
  Fly   250 GVCGKKYGDRHNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLF 314

  Fly   241 YTAGDLSKHMITHTGI---KNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAID 302
            .:...|..|..||:|.   |:.||..|||.|...:.:|.|..:.|..|..               
  Fly   315 ISQRHLMCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKP--------------- 364

  Fly   303 TDPVGLDTLDHAHFKCPDCDKAFDTADSLSLH-FRTHAANNN--------LLNLPLPPAPPMSHH 358
                         :||.:|.:.|.:.....:| ...|..|..        |...|....|.:.||
  Fly   365 -------------YKCANCTEVFASYAEKRIHMLERHRENLTAIERSECMLCRQPFSSEPDLIHH 416

  Fly   359 YHHDALHHLGPP 370
            ...:.|...|.|
  Fly   417 MSAEHLQRPGAP 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 22/90 (24%)
COG5048 146..>211 CDD:227381 18/64 (28%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
zf-H2C2_2 189..213 CDD:404364 7/23 (30%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 233..253 CDD:275368 6/21 (29%)
zf-H2C2_2 245..270 CDD:404364 12/27 (44%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368 4/20 (20%)
CG8301NP_649915.1 zf-AD 3..87 CDD:285071 21/88 (24%)
COG5048 198..>508 CDD:227381 62/261 (24%)
C2H2 Zn finger 221..241 CDD:275368 7/19 (37%)
C2H2 Zn finger 249..269 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 6/21 (29%)
C2H2 Zn finger 338..359 CDD:275368 7/20 (35%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368
C2H2 Zn finger 480..500 CDD:275368
C2H2 Zn finger 508..528 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..582 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.