Sequence 1: | NP_609786.2 | Gene: | CG17328 / 34962 | FlyBaseID: | FBgn0028895 | Length: | 413 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
Alignment Length: | 335 | Identity: | 84/335 - (25%) |
---|---|---|---|
Similarity: | 125/335 - (37%) | Gaps: | 76/335 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 KICRVCLEELHPVTSIYSTD---------FAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRLG 62
Fly 63 VAFHFKQEC------------------------------ENSDLRLRQYLGI----LESWRQDAA 93
Fly 94 TNTDFVEKPLLPQRDSDEEEP---------------------VDAKVSKRRSRYQRKPPEEHKKR 137
Fly 138 GPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKP 202
Fly 203 FQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKA 267
Fly 268 FSRRRDMRTH 277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17328 | NP_609786.2 | zf-AD | 8..80 | CDD:214871 | 17/110 (15%) |
COG5048 | 146..>211 | CDD:227381 | 26/64 (41%) | ||
C2H2 Zn finger | 149..169 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 189..213 | CDD:404364 | 13/23 (57%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 245..270 | CDD:404364 | 12/24 (50%) | ||
C2H2 Zn finger | 261..282 | CDD:275368 | 9/17 (53%) | ||
C2H2 Zn finger | 318..338 | CDD:275368 | |||
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | 14/79 (18%) |
C2H2 Zn finger | 198..218 | CDD:275368 | 5/19 (26%) | ||
COG5048 | 222..>276 | CDD:227381 | 23/53 (43%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 9/17 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |