DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and ouib

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:332 Identity:88/332 - (26%)
Similarity:136/332 - (40%) Gaps:83/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ICRVC--------------------LEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDGLPSV 52
            :||||                    |:.||.::.                   :|:...|.:|..
  Fly     5 VCRVCGRQKICEKSLNLFDLVNRKYLKHLHMISG-------------------LRLVDLDDVPGF 50

  Fly    53 ICNNCIYRLGVAFHFKQECENSDLRLRQYLGIL-ESWRQDAATN------------TDFVEKPLL 104
            :|..|...|..|..|::.|..:..:   :|.|. :|...|..||            :||.:|   
  Fly    51 MCLCCQAELRSALAFRKLCIKTQTK---WLTIEDDSSSGDEDTNDNSELESEKCAFSDFGKK--- 109

  Fly   105 PQRDSD----------EEEPVDAKVSKRRSRYQRKPPEEHKKRGP-----KPVPKMPHTCYEC-- 152
              ::.:          ||||:| |...|.::.|.:.....:|..|     |...|:....|.|  
  Fly   110 --KEGELVEETFQVLIEEEPMD-KTLNRDAKAQLREDGIDEKCVPSQKIIKVSTKLDDQIYICEL 171

  Fly   153 ---HKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSA 214
               |.:.|...|  :|:|.|.||:|:.|..|..||.....|:.|.|.|||::||.|..|.|::.:
  Fly   172 CGTHATSKPTFQ--RHMRKHRGERPFGCKDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVS 234

  Fly   215 LGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKL 279
            ......|::.|...|..||..|.|.|.||..|..||:.|||.:|..||:|.::|.|:..:.||..
  Fly   235 YMGRLIHERTHTNDRPYVCEECGKKFTTAYVLKNHMVIHTGERNFRCDICDRSFQRKAHLVTHTR 299

  Fly   280 KLHPLES 286
            .:..|::
  Fly   300 SMMHLQN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 16/91 (18%)
COG5048 146..>211 CDD:227381 25/69 (36%)
C2H2 Zn finger 149..169 CDD:275368 7/24 (29%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 11/23 (48%)
C2H2 Zn finger 205..225 CDD:275368 4/19 (21%)
C2H2 Zn finger 233..253 CDD:275368 9/19 (47%)
zf-H2C2_2 245..270 CDD:404364 11/24 (46%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368
ouibNP_649822.2 zf-AD 5..78 CDD:214871 16/94 (17%)
COG5048 <158..300 CDD:227381 51/143 (36%)
C2H2 Zn finger 169..189 CDD:275368 6/21 (29%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 209..234 CDD:290200 11/24 (46%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
zf-H2C2_2 241..262 CDD:290200 8/20 (40%)
C2H2 Zn finger 253..273 CDD:275368 9/19 (47%)
zf-H2C2_2 266..288 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..299 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.