DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG17359

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:348 Identity:106/348 - (30%)
Similarity:154/348 - (44%) Gaps:81/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NIHKICRVCLEELHPVTSIYSTDFAMMPSV---------MLMQCAKIRVFKTDGLPSVICNNCIY 59
            :|.::||||.:|...:..||:..:|....|         ||.:|:...|.|.||:|..||..|..
  Fly     2 DISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSVHKEDGMPQFICVECAE 66

  Fly    60 RLGVAFHFKQECENS-----DLRLR-------QY-------------LGILESWRQDAATNTDFV 99
            .:..|:..:::|..|     .|||.       :|             :.::|:.:....:....|
  Fly    67 AVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVMEAGKTPETSEPLLV 131

  Fly   100 E-----------KPL-LPQRDSDEEEPVD----AKV----SKRRSR-------YQRKPPEEHK-- 135
            |           ||: .|..|::|.:...    ||.    ||||:|       :......||:  
  Fly   132 ELVQVKYMPPEPKPISSPLPDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDD 196

  Fly   136 -------KRG-PKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKV 192
                   ||| ||.||. |:.|..|.:||.....|..|:|.||||:||:||.|.:.||||.||:.
  Fly   197 DKIWNASKRGKPKRVPG-PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQS 260

  Fly   193 HERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIK 257
            |.|.|||::||.|..|.|:|..:|..|.|.:.|.|.:...||.||:.|.....|.|||..||.  
  Fly   261 HTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHTR-- 323

  Fly   258 NHHCDVCGKAFSRRRDMRTHKLK 280
                   ||..:..::.:.:|.|
  Fly   324 -------GKRRTSSQETKRNKFK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 26/92 (28%)
COG5048 146..>211 CDD:227381 32/64 (50%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
C2H2 Zn finger 177..197 CDD:275368 11/19 (58%)
zf-H2C2_2 189..213 CDD:404364 12/23 (52%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
C2H2 Zn finger 233..253 CDD:275368 9/19 (47%)
zf-H2C2_2 245..270 CDD:404364 8/24 (33%)
C2H2 Zn finger 261..282 CDD:275368 4/20 (20%)
C2H2 Zn finger 318..338 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 23/81 (28%)
zf-C2H2 215..237 CDD:278523 7/21 (33%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275368 11/19 (58%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 9/23 (39%)
C2H2 Zn finger 301..321 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.