DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and CG10321

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster


Alignment Length:197 Identity:57/197 - (28%)
Similarity:81/197 - (41%) Gaps:49/197 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LTQHIRTHT---GEKPYQCSFCIQRFAQKYNLKVHERTHTG------DKPFQCEICSKQFSALGN 217
            :|:.||.||   |...|.|..|...|.|...|:.|..:||.      .|..||:||.|.|...|.
  Fly   609 VTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGM 673

  Fly   218 FQAHQKIH-LGVRDQVCSLCQKGFYTAGDLSKHMITH------TGIKNHHCDVCGKAFSRRRDMR 275
            .:.|.|.| ......:|::|.:.|.:...|.:|..||      .|:.|     |.|.||...:::
  Fly   674 LRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQQRAYCCGVAN-----CRKNFSSAVNLK 733

  Fly   276 THKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRT--H 338
            .|..:.||       ::|          ||:         |||.:|...:|..|||.||..:  |
  Fly   734 WHVERKHP-------EVV----------DPL---------FKCGECGSLYDNVDSLQLHVESTDH 772

  Fly   339 AA 340
            :|
  Fly   773 SA 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 20/57 (35%)
C2H2 Zn finger 149..169 CDD:275368 3/6 (50%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
zf-H2C2_2 189..213 CDD:404364 10/29 (34%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
zf-H2C2_2 245..270 CDD:404364 9/30 (30%)
C2H2 Zn finger 261..282 CDD:275368 5/20 (25%)
C2H2 Zn finger 318..338 CDD:275368 8/21 (38%)
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 8/19 (42%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 7/27 (26%)
C2H2 Zn finger 750..767 CDD:275368 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.