DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and MESR4

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:376 Identity:73/376 - (19%)
Similarity:115/376 - (30%) Gaps:150/376 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FAMMPSVMLMQCAKIRVFKTDGLPSVICNNCIYRLGVAFHFKQ---------------------- 69
            |:|:..|.|  |.| .|:.       :|..|.:...:|.:.||                      
  Fly  1032 FSMVDFVRL--CLK-SVYS-------LCLYCNHARRIAVNVKQLVIHLIGQHRFTATVDSITAEE 1086

  Fly    70 -ECENSDLRLRQYLGILESWRQDAAT-----NTDFVEKPLLPQRDSDEEEPVDAKV--------- 119
             ..|....:|:.:|..||:...:||:     |..:|             ||.:.::         
  Fly  1087 LYAETIVAKLKSFLPNLENEYMNAASCCSLENGKYV-------------EPFNERIYECFTCRFV 1138

  Fly   120 -SKRRSRYQRKPPEEHKKRGPKPVPKMPH-----TCYECHKSFKCIAQLTQHIRTHTGEKPYQCS 178
             |..:..|      .|.:|        .|     ||..|..:|...:::..||            
  Fly  1139 TSTHKELY------THNRR--------LHIKSNITCVMCQTNFYSYSEILCHI------------ 1177

  Fly   179 FCIQRFA-QKYNLKVHERTHTGDKPFQCEICS-----KQFSALGNFQAHQKIHLGVRDQVCSLCQ 237
             |....| ..|:|:           |:|.:|.     ..|..:        :||..:.|.|.:|.
  Fly  1178 -CPGEVAGSVYDLQ-----------FRCCLCDMAPLPSAFRLM--------VHLRKQHQACDICL 1222

  Fly   238 KGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESS------------TNH 290
            :...:...||.|:..|..:  |.|..||.|:..::|:..|....|..||:            ..|
  Fly  1223 EDCQSQSKLSSHVWKHKLL--HLCYRCGIAYRNKQDISKHLFWKHGTESAGCKQCLQKRWRHVYH 1285

  Fly   291 DIVDDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAAN 341
            ..|..                  |.|.|..|...|..|..|.:|.|.|..:
  Fly  1286 FCVPP------------------AEFPCEQCGFVFSKAIYLEVHQRMHTGD 1318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 14/75 (19%)
COG5048 146..>211 CDD:227381 14/75 (19%)
C2H2 Zn finger 149..169 CDD:275368 5/19 (26%)
C2H2 Zn finger 177..197 CDD:275368 4/20 (20%)
zf-H2C2_2 189..213 CDD:404364 4/28 (14%)
C2H2 Zn finger 205..225 CDD:275368 3/24 (13%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
zf-H2C2_2 245..270 CDD:404364 9/24 (38%)
C2H2 Zn finger 261..282 CDD:275368 6/20 (30%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 1/15 (7%)
C2H2 Zn finger 1295..1315 CDD:275370 7/19 (37%)
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.