DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and Oaz

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001188929.1 Gene:Oaz / 36609 FlyBaseID:FBgn0284250 Length:1366 Species:Drosophila melanogaster


Alignment Length:387 Identity:76/387 - (19%)
Similarity:114/387 - (29%) Gaps:153/387 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 SRYQRKPPEEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKY 188
            |::.:...|..|.||..     .:.|..|.|:|..:..|..|:::|....|::|.:|.:.|..|.
  Fly   274 SKFDKLTGEGIKSRGDG-----SYQCQFCEKTFPRLGYLKHHVQSHAEHLPFKCEYCSKLFKHKR 333

  Fly   189 NLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITH 253
            :...|::.||.::.::|..|...||...:.:.|.|.|...:...||:|.:|:.||..|:.||..|
  Fly   334 SRDRHKKLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKPFQCSMCNRGYNTAAALTSHMQKH 398

  Fly   254 ----------------------TGI------------------------------------KNH- 259
                                  ||.                                    .|| 
  Fly   399 KKNAAILAAGGNPNALNYSPRSTGSASASVSSNGSLQKRRYALALASDSSPSRMDFPKRSRSNHV 463

  Fly   260 -------------HCDVCGKA--FSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLD 309
                         .|..|.|.  ||....:..|...:|           :....:|:.| ||  .
  Fly   464 GGTTTTATPTPLLRCSYCPKVTEFSSLEQLNAHLQSVH-----------EQPQTQAVKT-PV--Q 514

  Fly   310 TLDHAHFKCPDCDKAFDTADSLSLHFR-THAANNNLLNLPLPPAPPMSHHYHHDALHHLG----- 368
            ..:.....|..|...|.....|..|.| ||.  :.|       :.|.|::.|.:.|...|     
  Fly   515 EGEGFQLSCEYCTMKFGNIAGLFQHMRSTHM--DRL-------SSPNSYYEHFNRLATAGTFSPR 570

  Fly   369 --------------------------------------PPNPATQMGMAAMAHMLAPPPPPP 392
                                                  .|||..|.       .||||..||
  Fly   571 LALDLPKIKPDLGSPERESRPAEDDLPTDLSNNKRRPLTPNPQAQT-------PLAPPSAPP 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 17/64 (27%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
zf-H2C2_2 189..213 CDD:404364 5/23 (22%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
C2H2 Zn finger 233..253 CDD:275368 9/19 (47%)
zf-H2C2_2 245..270 CDD:404364 12/98 (12%)
C2H2 Zn finger 261..282 CDD:275368 6/22 (27%)
C2H2 Zn finger 318..338 CDD:275368 6/20 (30%)
OazNP_001188929.1 C2H2 Zn finger 294..314 CDD:275368 6/19 (32%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
zf-H2C2_2 334..359 CDD:290200 6/24 (25%)
COG5048 336..769 CDD:227381 59/320 (18%)
zf-C2H2 348..370 CDD:278523 6/21 (29%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 9/19 (47%)
C2H2 Zn finger 630..650 CDD:275368
C2H2 Zn finger 659..679 CDD:275368
C2H2 Zn finger 689..707 CDD:275368
C2H2 Zn finger 1020..1041 CDD:275368
C2H2 Zn finger 1049..1069 CDD:275368
C2H2 Zn finger 1197..1217 CDD:275368
C2H2 Zn finger 1229..1246 CDD:275368
C2H2 Zn finger 1258..1278 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.