DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and crol

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:354 Identity:92/354 - (25%)
Similarity:127/354 - (35%) Gaps:116/354 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSK 210
            ||.|..|.|:|.....|..|:|.||||.|::||:|::.|.:|.:|..|.|.|||:.||:|..|:|
  Fly   444 PHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTK 508

  Fly   211 QFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSKHMITHTGIKNHHCDVCGKAFSRRRDMR 275
            .|:...:...|.:.|.|.....|:.|.|.|.....|:.|:..|||...|.|..|.|.|:|:    
  Fly   509 AFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRK---- 569

  Fly   276 THKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTHAA 340
                     |..|||               |.|.|.|..| ||..|.|.|...:.|:.|.|.|::
  Fly   570 ---------EHLTNH---------------VRLHTGDSPH-KCEYCQKTFTRKEHLNNHMRQHSS 609

  Fly   341 NN----NLLNLPLPPAPPMSHH---------------------------YH-------------- 360
            :|    |:.|.|......:.:|                           :|              
  Fly   610 DNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPF 674

  Fly   361 -----------------HDALHHLGPPNPATQMGMAAM------AHM-------LAPPPPPPPTP 395
                             |...|....|:..|....|.:      .||       :.||||..|.|
  Fly   675 ACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAMMPPPPVHPHP 739

  Fly   396 S--EGRYTML----------HHTAAQRLH 412
            .  .|..|.:          ||:|...:|
  Fly   740 QIPAGVLTQVKQEVKPIIIPHHSATTTMH 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 29/64 (45%)
C2H2 Zn finger 149..169 CDD:275368 7/19 (37%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
zf-H2C2_2 189..213 CDD:404364 11/23 (48%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 10/24 (42%)
C2H2 Zn finger 261..282 CDD:275368 5/20 (25%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
C2H2 Zn finger 279..299 CDD:275368
COG5048 300..723 CDD:227381 80/307 (26%)
C2H2 Zn finger 307..327 CDD:275368
C2H2 Zn finger 335..355 CDD:275368
C2H2 Zn finger 363..383 CDD:275368
C2H2 Zn finger 391..411 CDD:275368
C2H2 Zn finger 419..439 CDD:275368
C2H2 Zn finger 447..467 CDD:275368 7/19 (37%)
C2H2 Zn finger 475..495 CDD:275368 8/19 (42%)
C2H2 Zn finger 503..523 CDD:275368 5/19 (26%)
C2H2 Zn finger 531..551 CDD:275368 6/19 (32%)
C2H2 Zn finger 559..579 CDD:275368 10/47 (21%)
C2H2 Zn finger 587..607 CDD:275368 7/19 (37%)
C2H2 Zn finger 615..636 CDD:275368 4/20 (20%)
C2H2 Zn finger 644..664 CDD:275368 1/19 (5%)
C2H2 Zn finger 676..696 CDD:275368 1/19 (5%)
C2H2 Zn finger 704..722 CDD:275368 3/17 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.