DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and prg

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001260253.1 Gene:prg / 34177 FlyBaseID:FBgn0285971 Length:558 Species:Drosophila melanogaster


Alignment Length:430 Identity:91/430 - (21%)
Similarity:157/430 - (36%) Gaps:110/430 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRVCLEELHPVT-SIYSTDFAMMPSVMLMQCAK----IRVFKTDGLPSVICNNCIYRLGVAFHFK 68
            ||:|.....|.: :|:.........|.:.:.:|    ::..:.:.|..:||:.|:..|..||..:
  Fly    17 CRLCHHNTDPNSLNIFDDTVQFCKDVSIAEVSKSLWSVQYDRNECLSELICSRCLEILEEAFELR 81

  Fly    69 QECENSDLRLRQYL-----------------------------------GILESWRQDAATNTD- 97
            :..:..:..|::.|                                   .:.||..::.|..:| 
  Fly    82 KGMQEREQSLQEQLKEMIKDHPKHRPGLNGNPGVFVPEEGCIIVEVDPENLAESSEEEFALGSDG 146

  Fly    98 ----FVEKPLLPQRDSDEEEPVDAK---------------------VSKRRSRYQRKPP------ 131
                :.:.....:.|.|||:..|.:                     |:...:..:.:|.      
  Fly   147 EYENYDDDDEEEEEDYDEEDEEDGQNGEDVDMPLGMDAAQMAAQQSVANNANTTEARPKRAFLCQ 211

  Fly   132 ------------EEHKKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIRT-HTGEKPYQCSFCIQR 183
                        :||:.....  |..|:.|..|:........|..||:| |..::||.|:.|.:.
  Fly   212 YCDLGFTLPAECQEHELAAHD--PNAPYCCNFCNIKLVTRPALISHIKTLHDPDRPYVCAHCRKG 274

  Fly   184 FAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDLSK 248
            |.::.:||.|...|||.:||.|.:|||.||...|...|.:||.||:..||..|.:.|.||.::.:
  Fly   275 FVRRSDLKKHTIVHTGVRPFTCNVCSKSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVEMMR 339

  Fly   249 HMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLH---------------PLESSTNHDIVDDDDD 298
            |..:|..:|...|..|..:||||..:..|: ::|               |:|.......:.....
  Fly   340 HTRSHGEVKAFQCGRCPYSFSRRDKLIAHQ-QVHTRRDMEQQQQMGLIPPMEGDLQQQALQAKQK 403

  Fly   299 EAIDTDPVGLDTLDHAHFKCPDCDKAFDTADSLSLHFRTH 338
            .|..|.       :..::.|..||:.|.....|..|...|
  Fly   404 AAAQTK-------NSRYYHCDVCDRTFQRERDLQRHQALH 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 15/75 (20%)
COG5048 146..>211 CDD:227381 24/65 (37%)
C2H2 Zn finger 149..169 CDD:275368 6/20 (30%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
zf-H2C2_2 189..213 CDD:404364 12/23 (52%)
C2H2 Zn finger 205..225 CDD:275368 8/19 (42%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 245..270 CDD:404364 6/24 (25%)
C2H2 Zn finger 261..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 318..338 CDD:275368 6/19 (32%)
prgNP_001260253.1 zf-AD 16..94 CDD:285071 15/76 (20%)
COG5048 <212..340 CDD:227381 42/129 (33%)
C2H2 Zn finger 239..260 CDD:275368 6/20 (30%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
zf-H2C2_2 280..305 CDD:290200 13/24 (54%)
zf-C2H2 294..316 CDD:278523 9/21 (43%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
zf-H2C2_2 308..331 CDD:290200 9/22 (41%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..372 CDD:275368 7/20 (35%)
C2H2 Zn finger 416..436 CDD:275368 6/19 (32%)
C2H2 Zn finger 443..464 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.