DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and zld

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster


Alignment Length:163 Identity:52/163 - (31%)
Similarity:79/163 - (48%) Gaps:16/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LLPQRDSDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPKPVPKMPHT---------CYECHKSFKC 158
            |..|..:..::|    ::|:|......|....::|........||:         |.||.|.|..
  Fly  1277 LADQTQTMAQQP----LAKKRRGGNATPSTTKRRRNSSVGSTSPHSTTLPSGRIKCLECDKEFTK 1337

  Fly   159 IAQLTQHIRT-HTGEKPYQCSFCIQRFAQKYNLKVHERTH-TGDKPFQCEICSKQFSALGNFQAH 221
            ...||||.:: |:||.|::|..|.:||..:.....|...| |.|||.:||:|.|||....:.:.|
  Fly  1338 NCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDLRRH 1402

  Fly   222 -QKIHLGVRDQVCSLCQKGFYTAGDLSKHMITH 253
             :.||.|::..:|.:|:|||.....|.||:.||
  Fly  1403 VEAIHTGLKQHMCDICEKGFCRKDHLRKHLETH 1435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 28/75 (37%)
C2H2 Zn finger 149..169 CDD:275368 9/20 (45%)
C2H2 Zn finger 177..197 CDD:275368 5/19 (26%)
zf-H2C2_2 189..213 CDD:404364 11/24 (46%)
C2H2 Zn finger 205..225 CDD:275368 7/20 (35%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
zf-H2C2_2 245..270 CDD:404364 5/9 (56%)
C2H2 Zn finger 261..282 CDD:275368
C2H2 Zn finger 318..338 CDD:275368
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 25/60 (42%)
C2H2 Zn finger 1328..1349 CDD:275368 9/20 (45%)
C2H2 Zn finger 1357..1377 CDD:275368 5/19 (26%)
C2H2 Zn finger 1386..1407 CDD:275368 7/20 (35%)
zf-H2C2_2 1398..1422 CDD:290200 7/23 (30%)
zf-C2H2 1413..1435 CDD:278523 8/21 (38%)
C2H2 Zn finger 1415..1435 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.