DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and dwg

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_477338.3 Gene:dwg / 31265 FlyBaseID:FBgn0000520 Length:592 Species:Drosophila melanogaster


Alignment Length:543 Identity:113/543 - (20%)
Similarity:163/543 - (30%) Gaps:246/543 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRVC---------LEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDG--LPSVICNNCIYRLG 62
            ||.|         |:|...:.|..||..|.    ||..|..:.....||  :|..||.:|:..|.
  Fly    14 CRTCTRACKLHKPLQEEIDLGSEGSTTLAS----MLNYCTGLSFEPQDGAAMPQHICLHCLQLLE 74

  Fly    63 VAFHFKQECENSDLRLR------------------------------------QYLGI------- 84
            .||:||:...:||..||                                    :|:.|       
  Fly    75 QAFNFKRMVIDSDELLRLGLDEARCSSFHESQTHSPNQSQQHDQQQQAFDSTEEYVMIEMLNEEQ 139

  Fly    85 ----------LESWRQDAATNTDFVEKPLLPQRDSDEE--------------------------- 112
                      .|..|:..|...|..|:.|..:.|.|:|                           
  Fly   140 ENVANLDEELAEEDRRIFAMTVDEEEEFLTEEVDQDDELSEEEHQLAQSGDQQEEHITMESVHEF 204

  Fly   113 EP-----------------------------------------------VDAKVSKRRSRYQRKP 130
            :|                                               :|..:.:.....:...
  Fly   205 QPAEVEYVTIKNEFETIVTEEDEFEVMNDSGAHDAILDCQMIVIPAEGAIDEVIGEETLELEGDG 269

  Fly   131 PEEH-------------------KKRGPKPVPKMPHTCYECHKSFKCIAQLTQHIR--------- 167
            .|||                   ....|.....:|:.|..|.|:|:...:|.||:|         
  Fly   270 REEHLLPEAEDVCEDEDFLEESLDSAPPTAGEALPYVCTVCQKAFRQQCRLNQHMRSHVDEKQYE 334

  Fly   168 -------------------THTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFS 213
                               |||..||:|||.|.:.:....:|.||:|||...||:.|:.|.:.::
  Fly   335 CEECGKRLKHLRNYKEHMLTHTNVKPHQCSICGRFYRTTSSLAVHKRTHAEKKPYNCDQCGRGYA 399

  Fly   214 ALGNFQAHQKIHLGVRDQVCSLCQKGFYTAGDL----------------------------SKHM 250
            |..:.:.|:..|.|.|...|.||.|.:|.:..|                            .|||
  Fly   400 AFDHLRRHKLTHTGERPYACDLCDKAYYDSSSLRQHKISHTGKKAFTCEICGVGLSQKSGYKKHM 464

  Fly   251 ITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLDTLDHAH 315
            :.|:|:|.|.|||||.||:...::..| ::||..|..                            
  Fly   465 MVHSGVKAHKCDVCGHAFTFTSNLNAH-VRLHSGEKP---------------------------- 500

  Fly   316 FKCPDCDKAFDTADSLSLHFRTH 338
            |||..|.|||.|...|:.|.|.|
  Fly   501 FKCEVCVKAFPTKKRLASHMRVH 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 27/117 (23%)
COG5048 146..>211 CDD:227381 28/92 (30%)
C2H2 Zn finger 149..169 CDD:275368 8/47 (17%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 10/23 (43%)
C2H2 Zn finger 205..225 CDD:275368 4/19 (21%)
C2H2 Zn finger 233..253 CDD:275368 9/47 (19%)
zf-H2C2_2 245..270 CDD:404364 15/52 (29%)
C2H2 Zn finger 261..282 CDD:275368 8/20 (40%)
C2H2 Zn finger 318..338 CDD:275368 9/19 (47%)
dwgNP_477338.3 zf-AD 14..91 CDD:214871 25/80 (31%)
COG5048 <297..451 CDD:227381 40/153 (26%)
C2H2 Zn finger 307..327 CDD:275368 8/19 (42%)
C2H2 Zn finger 335..355 CDD:275368 0/19 (0%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
COG5048 <387..523 CDD:227381 44/164 (27%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
zf-H2C2_2 403..426 CDD:290200 8/22 (36%)
C2H2 Zn finger 419..439 CDD:275368 6/19 (32%)
C2H2 Zn finger 447..467 CDD:275368 3/19 (16%)
C2H2 Zn finger 475..495 CDD:275368 8/20 (40%)
zf-H2C2_2 487..510 CDD:290200 9/51 (18%)
C2H2 Zn finger 503..523 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2264
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.