DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and prz1

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:49/175 - (28%)
Similarity:80/175 - (45%) Gaps:22/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IYRLGVAFHFKQEC--ENSDLRLRQYLGILESWRQDAATNTDFVEKPLLPQRDSDEEEPVDAKV- 119
            |.:|...|....||  .|.|..|   ||.:|:   |.:.:.|:    |..:........:::.| 
pombe   495 IPQLYTHFSHSSECLSVNQDTEL---LGKIEN---DNSKSNDY----LSVRNTRPRSRSLNSLVG 549

  Fly   120 SKRRSRYQRKPPEEHKKRGPKPVPKMPHTC--YECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQ 182
            :|..:....|...|.|.:|       .:.|  ..|:|.|.....|..|:.|||..:|:|||.|.:
pombe   550 NKSENSSSSKAKSESKSQG-------NYVCTFAGCNKRFTRAYNLKSHMNTHTNYRPFQCSICKK 607

  Fly   183 RFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIHLG 227
            .||::::.:.||:.|||.|.|.|..|:::|:.:.....|.|..:|
pombe   608 SFARQHDKRRHEQLHTGIKAFACVTCNQRFARMDALNRHYKSEVG 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 8/23 (35%)
COG5048 146..>211 CDD:227381 25/66 (38%)
C2H2 Zn finger 149..169 CDD:275368 6/21 (29%)
C2H2 Zn finger 177..197 CDD:275368 7/19 (37%)
zf-H2C2_2 189..213 CDD:404364 9/23 (39%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368
zf-H2C2_2 245..270 CDD:404364
C2H2 Zn finger 261..282 CDD:275368
C2H2 Zn finger 318..338 CDD:275368
prz1NP_593073.1 COG5048 121..620 CDD:227381 37/141 (26%)
zf-C2H2 570..594 CDD:278523 6/23 (26%)
C2H2 Zn finger 577..594 CDD:275368 5/16 (31%)
zf-H2C2_2 586..611 CDD:290200 11/24 (46%)
C2H2 Zn finger 602..622 CDD:275368 7/19 (37%)
zf-H2C2_2 616..639 CDD:290200 10/22 (45%)
C2H2 Zn finger 630..648 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.