DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and klf-3

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:136 Identity:50/136 - (36%)
Similarity:67/136 - (49%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VEKPLLP-----QRDSDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPKPVPKMPHTC-YE-CHKSF 156
            :|.|:.|     :.||....| .:..|..||..|||...|..||.|.....:.|.| |. |.|.:
 Worm   178 MEIPMHPLPHNGELDSTRSSP-SSTTSSERSPLQRKSRIESNKRNPTDKKFVVHACTYPGCFKKY 241

  Fly   157 KCIAQLTQHIRTHTGEKPYQCSF--CIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQ 219
            ...:.|..|.|||:||||:.|.:  |..:||:...|..|.|.|||||||:|.:|.:.|:...:..
 Worm   242 SKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNFARSDHLS 306

  Fly   220 AHQKIH 225
            .|.|.|
 Worm   307 LHMKRH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871
COG5048 146..>211 CDD:227381 30/68 (44%)
C2H2 Zn finger 149..169 CDD:275368 7/21 (33%)
C2H2 Zn finger 177..197 CDD:275368 7/21 (33%)
zf-H2C2_2 189..213 CDD:404364 12/23 (52%)
C2H2 Zn finger 205..225 CDD:275368 5/19 (26%)
C2H2 Zn finger 233..253 CDD:275368
zf-H2C2_2 245..270 CDD:404364
C2H2 Zn finger 261..282 CDD:275368
C2H2 Zn finger 318..338 CDD:275368
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 5/18 (28%)
C2H2 Zn finger 262..284 CDD:275368 7/21 (33%)
zf-H2C2_2 276..301 CDD:290200 13/24 (54%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.