DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17328 and sem-4

DIOPT Version :9

Sequence 1:NP_609786.2 Gene:CG17328 / 34962 FlyBaseID:FBgn0028895 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_491997.1 Gene:sem-4 / 172435 WormBaseID:WBGene00004773 Length:744 Species:Caenorhabditis elegans


Alignment Length:507 Identity:103/507 - (20%)
Similarity:156/507 - (30%) Gaps:181/507 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CRVCLEELHPVTSIYSTDFAMMPSVMLMQCAKIRVFKTDG-----LPSVIC------NNCIY--- 59
            |.||           :|.|:....:...:|.|....::..     :||.:|      ..|:.   
 Worm   133 CDVC-----------TTTFSNGQDIREHKCQKTLASRSTSVPPSTIPSSVCFLSTPTTPCLQFSI 186

  Fly    60 --RLGVAFHFKQECENSDLRL-------RQYLGILESWRQDAAT-----NTDF------------ 98
              .:|.: ..::|.|..|:.:       .|..|.|.....|.:.     |..|            
 Worm   187 NESIGTS-EIREEDEEEDMDVEDGEHVANQLFGHLLQKSDDKSKMASLFNHAFPPFAAFPNMPPP 250

  Fly    99 --VEKPLLPQRD---------------------SDEEEPVDAKVSKRRSRYQRKPPEEHKKRGPK 140
              :.:|..|:.|                     |||.|.:.|.|                  |.|
 Worm   251 FLMRQPFDPRADVFAAGRHDNDDDWEALMEISTSDEAEKIRALV------------------GDK 297

  Fly   141 PVPKM-PHTCYECHKSFKCIAQLTQHIRTHTGEKPYQCSFCIQRFAQKYNLKVHERTHTGDKPFQ 204
            .||.. |:.|..|.:...|.:.|..|.||||||:|::|..|.:.|..|.|||.|...|.....|:
 Worm   298 AVPTTDPNQCILCRRVLSCKSALQMHYRTHTGERPFKCKICQRAFTTKGNLKTHMGVHRSKHSFR 362

  Fly   205 CEICS--KQFSALGNFQAH----QKIHLG----------------VRDQVCSLCQKGFYTAGDLS 247
            ....|  .|.:|:...|..    |:||:.                ...|.|.:||:.|..||:|:
 Worm   363 GLPISLPPQLAAMHQHQHQIAPPQRIHIHNPPTSAASAAAAVAQIQASQQCPICQQRFLNAGELA 427

  Fly   248 KHMITHTGIKNHHCDVCGKAFSRRRDMRTHKLKLHPLESSTNHDIVDDDDDEAIDTDPVGLDTLD 312
            .|:..|                  |:..|...::.|..::|.   |.........|.|..|:   
 Worm   428 VHITEH------------------RNSLTQPPRVMPTPTTTR---VQTFPFVPFFTTPPSLN--- 468

  Fly   313 HAHFKCPDCDKAFDTADSLSLHFRTHAANN----------------NLLNLPLPPAPPMSHHYHH 361
                 ..|....|:.|:.||...:..::.|                .:.:|....:...|.....
 Worm   469 -----ATDMSTQFNLANILSAQLKNDSSPNTDTSSVEEKITRDDPPKMASLSPSNSSDSSSSVRQ 528

  Fly   362 DALHH--------------------LGPPNPATQMGMAAMAHMLAPPPPPPP 393
            |.|..                    ...|||..:..:.||..|.|...||||
 Worm   529 DILESSEFEEKLKKLEEPPILEQQVSTTPNPKNENPLLAMQKMWAETEPPPP 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17328NP_609786.2 zf-AD 8..80 CDD:214871 15/93 (16%)
COG5048 146..>211 CDD:227381 24/66 (36%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
C2H2 Zn finger 177..197 CDD:275368 8/19 (42%)
zf-H2C2_2 189..213 CDD:404364 8/25 (32%)
C2H2 Zn finger 205..225 CDD:275368 5/25 (20%)
C2H2 Zn finger 233..253 CDD:275368 8/19 (42%)
zf-H2C2_2 245..270 CDD:404364 3/24 (13%)
C2H2 Zn finger 261..282 CDD:275368 2/20 (10%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
sem-4NP_491997.1 C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
zf-H2C2_2 319..344 CDD:290200 12/24 (50%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
lambda-1 553..>610 CDD:212564 11/28 (39%)
zf-C2H2 589..611 CDD:278523
C2H2 Zn finger 591..611 CDD:275368
zf-H2C2_2 603..628 CDD:290200
C2H2 Zn finger 619..639 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2971
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.